Align ABC transporter (characterized, see rationale)
to candidate WP_109968320.1 DK846_RS07615 ABC transporter ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_003173355.1:WP_109968320.1 Length = 255 Score = 169 bits (429), Expect = 6e-47 Identities = 88/187 (47%), Positives = 125/187 (66%), Gaps = 3/187 (1%) Query: 22 VSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDLEPRERGVGMVF 81 VSL IA EFV FVGPSGCGK+TLLR+IAGLD G +L+DG +++ PR VGMVF Sbjct: 27 VSLSIADDEFVSFVGPSGCGKTTLLRIIAGLDQATSGSVLVDGNQISGPSPR---VGMVF 83 Query: 82 QSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQLDKLLQRKPKELSGGQRQR 141 Q Y+L+P ++ DN++FG ++ K E K ++ L++ + P ELSGG RQR Sbjct: 84 QEYSLFPWRNILDNVAFGPEMRGLSKVKRYELARKYISLVGLNQFEKSYPYELSGGMRQR 143 Query: 142 VAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGSTMIYVTHDQVEAMTLA 201 VA+ RA+A +PD+LL DEP LDA R +M++E+ + R T+++VTH EA+ L+ Sbjct: 144 VAIARALANDPDLLLMDEPFGALDAQTRNKMQSELLDIWGRSKKTILFVTHSVDEAVFLS 203 Query: 202 DKIVVLN 208 D+IVV++ Sbjct: 204 DRIVVMS 210 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 255 Length adjustment: 27 Effective length of query: 354 Effective length of database: 228 Effective search space: 80712 Effective search space used: 80712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory