Align Hydroxyacylglutathione hydrolase; EC 3.1.2.6; Glyoxalase II; Glx II (uncharacterized)
to candidate WP_109968716.1 DK846_RS09610 MBL fold metallo-hydrolase
Query= curated2:A9BEI3 (253 letters) >NCBI__GCF_003173355.1:WP_109968716.1 Length = 459 Score = 71.6 bits (174), Expect = 3e-17 Identities = 55/172 (31%), Positives = 81/172 (47%), Gaps = 29/172 (16%) Query: 27 SGQAVVVDPAVSEPVKEFLS---QNNLALNSVLQTHHHDDHIGGTRDLISNWPSASIIAC 83 +G +++DP S ++L+ Q + + +L+TH H D I G D IA Sbjct: 21 TGSCLIIDP--SRDPDQYLNAARQEGMKITGILETHLHADFISGHLD----------IAD 68 Query: 84 KTDLE-RIPFQTHS------VTDQEVFTLFGYSVKVLEVPGHTRGHVAYYLSDTNADNRN 136 KT +P + H+ V V T+ ++V E PGHT H++Y L + + Sbjct: 69 KTGAPIYMPERAHALFPHIPVHHGSVITIEDMRIEVRETPGHTPEHISYVLIHQSRSDSP 128 Query: 137 PALFCGDTLFAGGCGR--LFEGTPHEMFKSL-----KLLNSLPSNTKIYCAH 181 A+FCGDTLF G GR LF G E+ L K L +LP ++Y AH Sbjct: 129 VAVFCGDTLFVGDVGRPDLFPGRSQELASELFTSLHKELMTLPDYCEVYPAH 180 Lambda K H 0.319 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 459 Length adjustment: 28 Effective length of query: 225 Effective length of database: 431 Effective search space: 96975 Effective search space used: 96975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory