Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_109968320.1 DK846_RS07615 ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_003173355.1:WP_109968320.1 Length = 255 Score = 158 bits (399), Expect = 2e-43 Identities = 86/210 (40%), Positives = 129/210 (61%), Gaps = 4/210 (1%) Query: 4 SLDIAGINKRFGKGDK-SVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTE 62 +++I+ I ++F + D SV+ + V + +A EF+ VGPSGCGK+TLL IIAGLD+ T Sbjct: 3 NVEISEITRQFTRDDGLSVQAIGGVSLSIADDEFVSFVGPSGCGKTTLLRIIAGLDQATS 62 Query: 63 GEIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEV 122 G + + G + G PR + MVFQ Y+L+P ++ DN+ F EMR + K +R + + Sbjct: 63 GSVLVDGNQISGPSPR---VGMVFQEYSLFPWRNILDNVAFGPEMRGLSKVKRYELARKY 119 Query: 123 AAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIK 182 +++ ++ P +LSGG RQRVA+ RALA P L L DEP LDA+ R +M++E+ Sbjct: 120 ISLVGLNQFEKSYPYELSGGMRQRVAIARALANDPDLLLMDEPFGALDAQTRNKMQSELL 179 Query: 183 RLHQASGITSVYVTHDQVEAMTLGSRIAVM 212 + S T ++VTH EA+ L RI VM Sbjct: 180 DIWGRSKKTILFVTHSVDEAVFLSDRIVVM 209 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 255 Length adjustment: 27 Effective length of query: 328 Effective length of database: 228 Effective search space: 74784 Effective search space used: 74784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory