Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate WP_109969948.1 DK846_RS15740 amino acid ABC transporter ATP-binding protein
Query= uniprot:P70970 (276 letters) >NCBI__GCF_003173355.1:WP_109969948.1 Length = 250 Score = 131 bits (330), Expect = 1e-35 Identities = 81/214 (37%), Positives = 132/214 (61%), Gaps = 10/214 (4%) Query: 10 LYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISL-GSTVIQAGKKNKDLK 68 L ++ ++K+G + IG +G+GKSTLL+ +N L P G++ L G V +G + + Sbjct: 23 LKGVSFNVKKGETICFIGPSGTGKSTLLRCINQLTIPDSGKVLLNGEEVTHSGSQ---IN 79 Query: 69 KLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMNF-GVKKEDAEQKAREMLQLVGLSEELL 126 R+K+G+VFQ LF+ T ++++ + G+ +DA KA + LQ VG++E Sbjct: 80 HFRQKIGMVFQ--NFFLFDHLTAVRNVEIALLKVKGMNAKDARAKAMKELQQVGMAE-WA 136 Query: 127 DRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTT 186 D P ELSGGQ +RV+IA LAMDP+V++ DEPT+ LDP +E++++ +L G +T Sbjct: 137 DHFPAELSGGQAQRVSIARALAMDPDVMLFDEPTSALDPELTREVLEVMKKLALDG-MTM 195 Query: 187 ILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDL 220 ++VTH M A + A++++ M G I+ GSP+ L Sbjct: 196 LVVTHEMGFACSVANQILFMEHGVIKEQGSPQVL 229 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 250 Length adjustment: 25 Effective length of query: 251 Effective length of database: 225 Effective search space: 56475 Effective search space used: 56475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory