GapMind for catabolism of small carbon sources

 

Protein WP_110206994.1 in Nocardioides daejeonensis MJ31

Annotation: NCBI__GCF_003194585.1:WP_110206994.1

Length: 368 amino acids

Source: GCF_003194585.1 in NCBI

Candidate for 77 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med PotG aka B0855, component of Putrescine porter (characterized) 42% 99% 266.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 86% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 41% 89% 243.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 90% 235.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 90% 235.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-mannitol catabolism mtlK med ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) 41% 89% 235 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 40% 93% 234.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 42% 89% 228.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism malK med Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 41% 89% 226.9 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 80% 226.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism thuK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 80% 226.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 80% 226.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 80% 226.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 46% 72% 213.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 39% 91% 249.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 38% 99% 239.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 37% 99% 234.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 96% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 37% 99% 231.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 92% 230.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 39% 99% 227.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 40% 92% 224.9 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 36% 92% 223.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 93% 217.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 93% 216.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 93% 216.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 93% 216.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 93% 216.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 93% 216.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 93% 216.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 88% 216.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 35% 96% 213 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 39% 87% 210.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 38% 89% 209.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 37% 86% 207.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 42% 65% 195.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 86% 194.9 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 34% 96% 190.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 95% 184.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 34% 70% 172.9 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 32% 82% 166 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 67% 164.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 67% 164.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 67% 164.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 67% 164.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 83% 163.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 83% 163.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 35% 98% 162.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 37% 95% 154.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-asparagine catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 38% 94% 153.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-aspartate catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 38% 94% 153.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-glutamate catabolism gltL lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 38% 94% 153.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 37% 89% 153.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 37% 90% 153.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 39% 81% 149.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 37% 91% 149.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 37% 81% 129 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 120.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 120.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-leucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 120.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 120.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 120.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-valine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 99% 120.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4
L-phenylalanine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale) 30% 99% 114.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 47% 292.4

Sequence Analysis Tools

View WP_110206994.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPKNANTQEPLTGASIEVDRIRKVYGSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNI
IAGFIKADGGDVRVDGKSITSVPAHKRGLGMVFQHYALFPHMSVYDNVAYGLRRHGFPKA
EIPGLVADALEMVEMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKML
REQLQLEIRRLHKEMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCR
YAAEFIGVSNIMTGSRAGDVFTDTRNQTTHKVSGGAADGTVLMVRPERLRVSAGQVGPAG
HENALPAIVSDCVYLGSDRTVHVRTASGEEMVARTEVPRTDDGIQPGVPVTLTWNIEDAR
VLAEEAAR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory