Align BadK (characterized)
to candidate WP_110206856.1 DNK54_RS10265 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_003194585.1:WP_110206856.1 Length = 254 Score = 157 bits (396), Expect = 3e-43 Identities = 104/254 (40%), Positives = 143/254 (56%), Gaps = 11/254 (4%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGN-TRAFAAG 64 + T G VG+ITL+RP+ NALN A++D + AL A +AD + AIV+ G RAF AG Sbjct: 3 VTAHTDGPVGLITLDRPEKRNALNAAMIDGIVHALEAHEADPAVRAIVLTGTGDRAFCAG 62 Query: 65 ADIASMAAWSYSDVYGSNFITRNWETIRQI-----RKPVLAAVAGLAYGGGCELALACDI 119 D+ ++ S G+ T +++ KP++AAV G A GG EL LACD+ Sbjct: 63 MDLTRVS----SSEPGAPTTRPETSTYKRLLTDGSTKPLIAAVNGTAVAGGFELMLACDL 118 Query: 120 VIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSR 179 VI+ A+F LPE+ GL+ GAGGT LP I +A A ++ L+A ++A A GLV+ Sbjct: 119 VISAPHARFGLPEVARGLVAGAGGT-FLPLRIPRAVAFELALTAEAIDATRAHALGLVNH 177 Query: 180 VVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASAD 239 VV D + +ALATTIAA S A+ + L A + + AE + A D Sbjct: 178 VVPADEVLPRALALATTIAANSPHAVRLTRGLLRDATDLSAAEAWSHVDAAVTEVLAGPD 237 Query: 240 AREGIQAFLEKRAP 253 AREG QAFLE+R P Sbjct: 238 AREGAQAFLERRTP 251 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 254 Length adjustment: 24 Effective length of query: 234 Effective length of database: 230 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory