Align BadK (characterized)
to candidate WP_110208787.1 DNK54_RS19555 crotonase/enoyl-CoA hydratase family protein
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_003194585.1:WP_110208787.1 Length = 264 Score = 160 bits (404), Expect = 3e-44 Identities = 104/254 (40%), Positives = 136/254 (53%), Gaps = 11/254 (4%) Query: 7 LTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGAD 66 L E +G + +ITLNRP+ +N++N +L LG L + D + A+V+ RAF AG D Sbjct: 10 LYEVRGHIAVITLNRPEAMNSVNRSLATGLGHGLDRAEQDPEVRAVVVTATGRAFCAGMD 69 Query: 67 IASMAAWSYSDVYGSNFITRNWETIRQIR----KPVLAAVAGLAYGGGCELALACDIVIA 122 + + A V G W +R KPV+AAV G A GGG E+ LA D+ +A Sbjct: 70 LKAFARGEDVSVEGH----AEWGFAGMVRHPISKPVIAAVNGFAMGGGTEIVLAADLAVA 125 Query: 123 GRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVD 182 SA F LPE+K GL+ AGG RLPR I AM++ L+ R + A EA GLV+RVV Sbjct: 126 AESASFGLPEVKRGLVAAAGGVLRLPRQIPIRLAMELALTGRAVTAAEAAEIGLVNRVVA 185 Query: 183 DDRLRDETVALATTIAAFSAPALMALKESL--NRAFESTLAEGI-LFERRELHARFASAD 239 DD L D + LA IAA + A+ A K + F S L + I R L F + D Sbjct: 186 DDALMDAALELAEQIAANAPLAVQATKRMILEQARFGSDLDDEIWQHHDRVLLPVFQTKD 245 Query: 240 AREGIQAFLEKRAP 253 A EG AF EKR P Sbjct: 246 AMEGAVAFAEKRPP 259 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory