Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase (uncharacterized)
to candidate WP_110206031.1 DNK54_RS05865 citramalate synthase
Query= curated2:Q6D796 (343 letters) >NCBI__GCF_003194585.1:WP_110206031.1 Length = 535 Score = 69.3 bits (168), Expect = 2e-16 Identities = 37/97 (38%), Positives = 50/97 (51%) Query: 146 AVLLEEARKMESYGAEAIVIMDSAGAYFPDDVKERISTLVNGLTVPVGFHGHNNLGMSVI 205 A LE R GAE + + D+ G P V E + ++ V VG H HN+ G +V Sbjct: 160 AYALEVLRTAAEAGAEVVALCDTNGGMLPTWVSEVVHDVIETTGVRVGIHCHNDTGCAVA 219 Query: 206 NSVVAVQEGATIIDGTIRGFGAGAGNTQLEVLVAVFE 242 NS+ AV GAT + GT+ G+G GN L +VA E Sbjct: 220 NSLAAVDAGATHVQGTVNGYGERTGNADLITVVANLE 256 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 535 Length adjustment: 32 Effective length of query: 311 Effective length of database: 503 Effective search space: 156433 Effective search space used: 156433 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory