GapMind for catabolism of small carbon sources

 

Alignments for a candidate for mhpE in Nocardioides daejeonensis MJ31

Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase (uncharacterized)
to candidate WP_110206031.1 DNK54_RS05865 citramalate synthase

Query= curated2:Q6D796
         (343 letters)



>NCBI__GCF_003194585.1:WP_110206031.1
          Length = 535

 Score = 69.3 bits (168), Expect = 2e-16
 Identities = 37/97 (38%), Positives = 50/97 (51%)

Query: 146 AVLLEEARKMESYGAEAIVIMDSAGAYFPDDVKERISTLVNGLTVPVGFHGHNNLGMSVI 205
           A  LE  R     GAE + + D+ G   P  V E +  ++    V VG H HN+ G +V 
Sbjct: 160 AYALEVLRTAAEAGAEVVALCDTNGGMLPTWVSEVVHDVIETTGVRVGIHCHNDTGCAVA 219

Query: 206 NSVVAVQEGATIIDGTIRGFGAGAGNTQLEVLVAVFE 242
           NS+ AV  GAT + GT+ G+G   GN  L  +VA  E
Sbjct: 220 NSLAAVDAGATHVQGTVNGYGERTGNADLITVVANLE 256


Lambda     K      H
   0.319    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 410
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 343
Length of database: 535
Length adjustment: 32
Effective length of query: 311
Effective length of database: 503
Effective search space:   156433
Effective search space used:   156433
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory