Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate WP_110206770.1 DNK54_RS09790 acetyl-CoA C-acyltransferase
Query= SwissProt::Q8VPF1 (401 letters) >NCBI__GCF_003194585.1:WP_110206770.1 Length = 408 Score = 311 bits (798), Expect = 2e-89 Identities = 185/404 (45%), Positives = 245/404 (60%), Gaps = 9/404 (2%) Query: 4 EVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQAGE 63 ++ IC+ +RTP+G +GG A V LAA + LV+R +D +D+V LG GE Sbjct: 7 DIVICEPLRTPVGAYGGVFADVPVTTLAATVLAELVDRTG-LDGGDIDDVILGQCYPNGE 65 Query: 64 DNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVESMSR 123 + R+A L AGL VPG ++R C SG+ AV A +A+G + +V+AGG ESMS+ Sbjct: 66 APA-LGRVAALDAGLDVRVPGQQIDRRCGSGLQAVLNAAMQVATGASRMVVAGGAESMSQ 124 Query: 124 AP-YVMGKADSAFGRGQKIEDTTIGWRFINPLMKAQYGVDAMPETADNVADDYKVSRADQ 182 A Y +G G G ++ D R + + M ETA+N+ DY++SR DQ Sbjct: 125 AEHYALGLRTGIRGDGTRLMDRLARGR-VTAGGRNHPVPGGMIETAENLRRDYRISREDQ 183 Query: 183 DAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKG--ETVVDADEHLRPDTTLEALAKLKP 240 DA AL SQQ AQ AG F +EIVPVV+ G++G +T ++ DEH RP+TT EALA L+P Sbjct: 184 DALALASQQRWAEAQGAGRFDDEIVPVVVPGRRGRPDTHIEVDEHPRPETTAEALAALRP 243 Query: 241 VN---GPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAKVLGMASAGVAPRVMGI 297 V + TVTAGNASG NDG+ I+ + + GL A + A AGV P MGI Sbjct: 244 VRLAVDDEATVTAGNASGQNDGAAMCIVTTRAEADRRGLDAFVTLRAWAVAGVPPATMGI 303 Query: 298 GPVPAVRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELGIADDDARVNPNGGAIALGH 357 GPVPA L R + +A D+IELNEAFAAQ LA RELG+ADDDARVN NG I+LGH Sbjct: 304 GPVPATALALSRAGIDLAQLDLIELNEAFAAQVLACLRELGMADDDARVNVNGSGISLGH 363 Query: 358 PLGASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVERV 401 P+GA+GAR++ T +L + + GL TMC+G GQG+A E V Sbjct: 364 PVGATGARILATLARELRRREARFGLETMCIGGGQGLAAVFEAV 407 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 408 Length adjustment: 31 Effective length of query: 370 Effective length of database: 377 Effective search space: 139490 Effective search space used: 139490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory