Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate WP_110208130.1 DNK54_RS16745 2-keto-4-pentenoate hydratase
Query= metacyc::MONOMER-15110 (260 letters) >NCBI__GCF_003194585.1:WP_110208130.1 Length = 267 Score = 148 bits (373), Expect = 1e-40 Identities = 90/249 (36%), Positives = 137/249 (55%), Gaps = 1/249 (0%) Query: 6 IKDLARFLVDAEVEKKEVLKLTNEHPDLTVEDGYAIQEQLVQMKLEQGYRIVGPKMGLTS 65 I AR L+ A + ++ + V Y +QEQL+ ++ G +VG K+G TS Sbjct: 12 IDTAARRLIQAIETHTPCAPVRDQIGENDVAAAYQVQEQLIAARIAAGAVVVGRKIGATS 71 Query: 66 QAKMKQMNVNEPIYGYIF-DYMVVNGQELSMSELIHPKVEAEIAFILGKDIEGPGITGAQ 124 +A +Q+ V++P +G + D Q + MS L+ PKVEAE+AF+LG+D+ + AQ Sbjct: 72 KAVQEQLGVDQPDFGVLLADMEYREDQVVPMSRLLQPKVEAEVAFVLGEDLADGPLDVAQ 131 Query: 125 VLAATEYVVPALEIIDSRYQNFQFTLPDVIADNASSSRVFLGSTIKRPDNMELDLLGVTL 184 V A +Y V ALEI+DSR +N+ + D +ADNASS LGS + E + +++ Sbjct: 132 VRGAIDYAVAALEIVDSRIENWNISFGDTVADNASSGLYVLGSQRRTLAEFEPVEVEMSM 191 Query: 185 SINGQIKDLGAGAAVVGHPANSVAMLANMLARKGLKLKAGQIILSGGITGAVMLNVGDSV 244 +I+G G GAA +G P N+V+ LA G+ L+AGQ++LSG + + G V Sbjct: 192 TIDGVEVSTGNGAACLGDPLNAVSWLARYARDFGVPLRAGQVLLSGALGPMRPVEPGQVV 251 Query: 245 TGKFDGLGT 253 T LGT Sbjct: 252 TAHISSLGT 260 Lambda K H 0.317 0.137 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 267 Length adjustment: 25 Effective length of query: 235 Effective length of database: 242 Effective search space: 56870 Effective search space used: 56870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory