Align 2-hydroxymuconate semialdehyde hydrolase; HMSH; 2-hydroxymuconic semialdehyde hydrolase; EC 3.7.1.9 (characterized)
to candidate WP_110205229.1 DNK54_RS01780 alpha/beta fold hydrolase
Query= SwissProt::P23106 (281 letters) >NCBI__GCF_003194585.1:WP_110205229.1 Length = 323 Score = 95.9 bits (237), Expect = 1e-24 Identities = 86/278 (30%), Positives = 127/278 (45%), Gaps = 32/278 (11%) Query: 18 GYRTNLHDQGEGFPALLIHGSGPASPPGPTGAGSFRSSQTRRVIAPDMLGFGYSERPADG 77 GYR G G LLIHG G + T VI PD+LG G S++P Sbjct: 14 GYRRAYVKVGSGPALLLIHGLGCNHSTWAPVIETLARRHT--VIVPDLLGHGESDKPR-A 70 Query: 78 KYSQARWVEHAIGVLDALGIQQGDIVGNSFGGGLALALAIRHPERVRRLVLMGSVGVSFP 137 YS A + +L L I IVG+S GGG+A+ A + PER RLVL+ + G+ Sbjct: 71 DYSIAAYANGMRDLLSVLDIDAATIVGHSLGGGVAMQFAYQFPERTERLVLVAAGGLGPE 130 Query: 138 ITAGLE--TAWGYTPSLA-----NMRRLLDLFAHDRTLVNDELAELRYQASIRPGFQESF 190 +T + T G P LA +R L A R L N +A LR I +SF Sbjct: 131 VTPLIRAITTPGIQPLLALAALPGIRHLGT--AALRGLANKSVAALRDLDEIAD-IVDSF 187 Query: 191 AAMFPPPRQNGVDDLASNETD--------------IRALPNETLVIHGREDRIIPLQASL 236 A P + V ++ + D + LP V+ GR+D ++P++ + Sbjct: 188 A---DPRTRTAVRNVTRSVVDWGGQYVTMADRAYLVEGLP--ICVVWGRDDLVLPVRHAN 242 Query: 237 TLAQWIPNAQLHVFGQCGHWTQIEHAERFARLVENFLA 274 A +P+A++ + GH+ +H ERFA++V+ F+A Sbjct: 243 IAAALVPSARIEIMPNSGHFPHRDHPERFAKVVQEFVA 280 Lambda K H 0.320 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 323 Length adjustment: 27 Effective length of query: 254 Effective length of database: 296 Effective search space: 75184 Effective search space used: 75184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory