Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate WP_110204949.1 DNK54_RS00125 electron transfer flavoprotein subunit alpha/FixB family protein
Query= BRENDA::H6LBB1 (418 letters) >NCBI__GCF_003194585.1:WP_110204949.1 Length = 313 Score = 157 bits (397), Expect = 4e-43 Identities = 99/315 (31%), Positives = 161/315 (51%), Gaps = 13/315 (4%) Query: 74 ITVYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLMGTNITEKADELLKYGVDKVFV 133 I V VDH++G + T EL+ AR L G P A+ +G+ A+ L K+G +KV+ Sbjct: 4 ILVLVDHVDGAVKKPTLELLTIARRL----GEPS-AVFIGSG-DAPAEALAKFGAEKVYA 57 Query: 134 YDKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAPRVAARYRTGLTADCTIL 193 D ++K +++ P A VL+ +EK ++L+ ++ G+ +A R+A + +GL D + Sbjct: 58 VDDAQIKGYLVAPKAEVLQQLVEKTSAGAVLIPSSAEGKEIAARLAIKIDSGLITDAVDV 117 Query: 194 EMKENTDLVQIRPAFGGNIMAQIVTENTRPQFCTVRYKVFTAPERVNEPWGDVEMMDIEK 253 + V + F G+ Q P TV+ E + I Sbjct: 118 QAGP----VTTQSVFAGSYTVQAKVTKGTP-IITVKPNSAAPEEAAGAGAVEAFAPTISD 172 Query: 254 AKLVSAIEVMEVIKKEKGIDLSEAETIVAVGRGVKCEKDLDMIHEFAEKIGATVACTRPG 313 A + I + + +L+EA +V+ GRG D + A+ +GA V +R Sbjct: 173 AAKAAQIVASQPRQSTGRPELTEAAIVVSGGRGTG--GDFSAVEALADSLGAAVGASRAA 230 Query: 314 IEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQNSEYIIAINSDPKAPIFNIA 373 +++GW Q+G +G+TV P+L +A GISGA+Q AGMQ S+ I+A+N D +APIF + Sbjct: 231 VDSGWKPHTFQVGQTGKTVSPQLYVANGISGAIQHRAGMQTSKTIVAVNKDEEAPIFELV 290 Query: 374 HCGMVGDLYEILPEL 388 G+VGDL+ +LP L Sbjct: 291 DFGVVGDLHTVLPAL 305 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 313 Length adjustment: 29 Effective length of query: 389 Effective length of database: 284 Effective search space: 110476 Effective search space used: 110476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory