Align Acetate/haloacid transporter, Dehp2, with a possible atypical topology (characterized)
to candidate WP_110205269.1 DNK54_RS02035 MFS transporter
Query= TCDB::F8SVK1 (552 letters) >NCBI__GCF_003194585.1:WP_110205269.1 Length = 447 Score = 194 bits (493), Expect = 6e-54 Identities = 118/326 (36%), Positives = 174/326 (53%), Gaps = 11/326 (3%) Query: 12 PMTKEEKRVIFASSLGTVFEWYDFYLAGSLAAFISKSFFSGVNPTAAFIFTLLGFAAGFA 71 P +R I AS++G + EW D+ L +IS + F G + A +F L FA F Sbjct: 4 PTAPAVRRAIAASAIGNMTEWLDYGLYAYGVTYISAALFPG-DTEQATLFALATFAISFL 62 Query: 72 VRPFGALVFGRLGDMVGRKYTFLITIVIMGLSTCVVGFLPGYAAIGMASPVIFIAMRLLQ 131 VRP G + +G LGD VGRK +TI++M +T VG +P Y IG +P + +A+RL+Q Sbjct: 63 VRPLGGMFWGPLGDRVGRKAVLAVTILLMAGATLGVGLVPTYDRIGFWAPTLLVALRLVQ 122 Query: 132 GLALGGEYGGAATYVAEHAPANRRGFYTAWIQTTATLGLFLSLLVILGVRTAMGEDAFGA 191 G + GGEYGGAAT++AE+AP RRGF ++++ G L L++LG A+ + A A Sbjct: 123 GFSTGGEYGGAATFMAEYAPDRRRGFLGSFLEFGTLTGFSLGALLMLGFSLALDDTAMQA 182 Query: 192 WGWRIPFVASLVLLGISVWIRMQLHESPAFERIKAEGKTSKAP----LSEAFGQWKNLKI 247 WGWR+PF+ + L I +W+R + +SP FE E + P L E + Sbjct: 183 WGWRVPFLLAAPLGVIGLWLRSRAEDSPVFEEAAEERAVDEEPAVVRLRELVADHGRPLL 242 Query: 248 VILALIGVTAGQAVVWYTGQFYALFFLTQTLKVDGASANILIAIALLIGTPFFLFFGSLS 307 ++ AL+ VV YT Y +L + + + ++ I +L F F G LS Sbjct: 243 LLGALVMTL---NVVNYTLLSYMPTYLEAEIGLSTDQSLMVPVIGMLTMMLFLPFAGHLS 299 Query: 308 DRIGRKP---IILAGCLIAALTYFPL 330 DR+GRKP + + G IAA+ F L Sbjct: 300 DRVGRKPLWWVSVTGLFIAAVPMFLL 325 Score = 37.7 bits (86), Expect = 9e-07 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Query: 462 VIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPATAFAIVAAKGNIYSG 521 ++YV + I++ MFPT++R+ ++ Y++ FGG PA +V G+ Sbjct: 342 LLYVPQL-ATISSTFPAMFPTQVRFAGFAIAYNVSTSLFGGTAPALNDWLVGLTGSALVP 400 Query: 522 LWYPIIIALATFVIGLLFVRET 543 +Y +++A A + L V ET Sbjct: 401 AFY-MMLACAVGALALPAVVET 421 Lambda K H 0.325 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 33 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 552 Length of database: 447 Length adjustment: 34 Effective length of query: 518 Effective length of database: 413 Effective search space: 213934 Effective search space used: 213934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory