Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 228 bits (582), Expect = 2e-64 Identities = 141/360 (39%), Positives = 203/360 (56%), Gaps = 21/360 (5%) Query: 2 ARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVT 61 A + +D + KVY G + +I LDI GEFL L+G SG GKST L ++AG Sbjct: 14 ASIEVDRIRKVY-----GSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKAD 68 Query: 62 EGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVE 121 G++R++ + + V A R + MVFQ YAL+PH SV N+++GL G P EI V Sbjct: 69 GGDVRVDGKSITSVPAHKRGLGMVFQHYALFPHMSVYDNVAYGLRRH-GFPKAEIPGLVA 127 Query: 122 ETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTE 181 + +M+ + L R+P +LSGGQQQRVAL RA+V P V LMDEPL LD LR +++ E Sbjct: 128 DALEMVEMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLE 187 Query: 182 LQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIG 241 ++RL E+G+T V+VTHDQ EA+TM DR+A+L+ G++ Q+GTP + Y P+ + A FIG Sbjct: 188 IRRLHKEMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCRYAAEFIG 247 Query: 242 EPSMNLFDGSLSGDTFRG--DGFDYPLSGATRDQLGGASGLTLGIRPEDVTVGERRSG-- 297 N+ GS +GD F + + +SG G A G L +RPE + V + G Sbjct: 248 --VSNIMTGSRAGDVFTDTRNQTTHKVSG------GAADGTVLMVRPERLRVSAGQVGPA 299 Query: 298 --QRTFDAEVVVVEPQGNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFP-EDA 354 + A V G++ VH+R G+E T ++ G T+++ EDA Sbjct: 300 GHENALPAIVSDCVYLGSDRTVHVRTASGEEMVARTEVPRTDDGIQPGVPVTLTWNIEDA 359 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 368 Length adjustment: 30 Effective length of query: 353 Effective length of database: 338 Effective search space: 119314 Effective search space used: 119314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory