Align L-Arginine ABC transporter, ATPase component (characterized)
to candidate WP_110206230.1 DNK54_RS07055 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_18715 (254 letters) >NCBI__GCF_003194585.1:WP_110206230.1 Length = 231 Score = 155 bits (391), Expect = 9e-43 Identities = 93/233 (39%), Positives = 141/233 (60%), Gaps = 17/233 (7%) Query: 4 LEVQDLHKRY----GSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGK 59 LE+Q + K Y G+ E ++G+ AG+ ++++G SGSGKST + + L+ P +G+ Sbjct: 6 LELQGVRKTYSTGAGAVEAVRGIDAVVVAGEYVAVVGPSGSGKSTLMHILGCLDVPTSGR 65 Query: 60 ILLNNEELKLVAGKDGAMKAADPKQLQRMRSR-LSMVFQHFNLWSHMTALENIMEAPVHV 118 +LV G+D A A D QL +R+R + VFQ F+L +TAL N+ E P+ Sbjct: 66 --------QLVRGQDVA--AMDEAQLAAVRNREIGFVFQQFHLLPGLTALRNV-ELPLIY 114 Query: 119 LGVAKAEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTS 178 GV E R +A L +VG+ R D PG +SGG+QQRVAIARAL +P ++L DEPT Sbjct: 115 AGVTALERRRRATVALTRVGLGDRADHRPGELSGGQQQRVAIARALVTDPALVLADEPTG 174 Query: 179 ALDPELVGDVLKVMQALAVEGRTMVVVTHEMGFAREVSNQLVFLHKGIVEESG 231 LD DVL + + L +GRT+V++THE A E +++++ L G++E++G Sbjct: 175 NLDSRATADVLALFRELHDQGRTIVLITHEQEVAAE-ADRVLTLRDGLLEDAG 226 Lambda K H 0.317 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 231 Length adjustment: 23 Effective length of query: 231 Effective length of database: 208 Effective search space: 48048 Effective search space used: 48048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory