Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate WP_110206897.1 DNK54_RS10510 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >NCBI__GCF_003194585.1:WP_110206897.1 Length = 394 Score = 194 bits (494), Expect = 3e-54 Identities = 123/323 (38%), Positives = 176/323 (54%), Gaps = 5/323 (1%) Query: 37 LSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERHRRRSGQAVDAE-QV 95 L G PD D PA +V+AA+ +L G YA G R LR+ IA R G +D + +V Sbjct: 31 LGQGFPDADGPASVVEAAVSALRNGRNQYAPGIGVRELREAIARHQHRHYGLDLDPDTEV 90 Query: 96 VVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVPVPVRSENGFRVQA 155 VV GA + A + L++PGDEV+V EP Y +Y A+ G PV +R+ + +R+ Sbjct: 91 VVTTGATEGIAAALLGLVDPGDEVVVLEPYYDSYLAMIAFAGGVRRPVTLRAPD-YRLDV 149 Query: 156 EEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAHDLWMISDEVYSELLFDG- 214 + A +T RTR + LNSPHNP+G L +A+A+L + HDL +++DEVY L+FDG Sbjct: 150 AALQAAVTDRTRVILLNSPHNPTGTVLRPEELQAIADLAIEHDLVVVTDEVYEHLVFDGH 209 Query: 215 EHVSPASLPGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHLENLALCMLYGSPEFI 274 HV +LPGM +RT TL+S KS + TGW+VGW GPA L + + + S + Sbjct: 210 RHVPLCTLPGMFERTVTLSSAGKSFSFTGWKVGWATGPADLVGAVLAAKQWLSFTSGSPL 269 Query: 275 QDAACTALEAPLPELEAMREAYRRRRDLVIECLADSPGLRPLRPDGGMFVMVDIRPTGL- 333 Q A AL+ E + + RRDL+ LA + L P+G F + D+R G Sbjct: 270 QPAIAHALDHEWRAYEELAADLQLRRDLLCSGLA-ALDLDVRIPEGTYFALTDVRALGWP 328 Query: 334 SAQAFADRLLDRHGVSVLAGEAF 356 +AF L +R GV + + F Sbjct: 329 DGRAFCLALPERAGVVAIPTQGF 351 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 394 Length adjustment: 31 Effective length of query: 362 Effective length of database: 363 Effective search space: 131406 Effective search space used: 131406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory