Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_110205943.1 DNK54_RS05355 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_003194585.1:WP_110205943.1 Length = 321 Score = 186 bits (472), Expect = 6e-52 Identities = 121/283 (42%), Positives = 163/283 (57%), Gaps = 18/283 (6%) Query: 12 DTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMI 71 D +L + ++ FGGL A++ E +RG ITALIGPNGAGKTT FN +TGF +P G Sbjct: 42 DPILVADGITRAFGGLKAVDVAHLEVQRGVITALIGPNGAGKTTFFNLLTGFDRPDDGTW 101 Query: 72 TFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYT 131 +FN L R+P +R+ + V RTFQ ++ S LTVLEN+ VA + + Sbjct: 102 SFNGTK-----LNRMPAYRVARLGMV-RTFQLTKVLSRLTVLENMRVAARGQTGERWWAA 155 Query: 132 ILGLIGVGPYKREAAEAIE-LARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGP 190 + + G A + LARF L+K +A D AG L G ++ LE+ARA+ P Sbjct: 156 LFAPLWRGQENENTDRAHDLLARFLLDK-----KAADFAGSLSGGQRKLLEMARALMVDP 210 Query: 191 ELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQK 250 EL+ LDEP AG+NP +L +KS+R E G ++L +EHDM +V +ISD VVV+ GQ Sbjct: 211 ELVMLDEPMAGVNPALKQSLLGHVKSLRDE-GRTVLFVEHDMDMVRDISDWVVVMAQGQV 269 Query: 251 ISDGTPDHVKNDPRVIAAYLGVEDE-----EVEEVIAAVEQLE 288 I++G PD V DPRVI AYLG + E EE I Q E Sbjct: 270 IAEGPPDSVMADPRVIDAYLGAHHDTKLTFEAEEKILDAAQQE 312 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 321 Length adjustment: 27 Effective length of query: 265 Effective length of database: 294 Effective search space: 77910 Effective search space used: 77910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory