Align Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (characterized)
to candidate WP_110208921.1 DNK54_RS20740 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_4510 (258 letters) >NCBI__GCF_003194585.1:WP_110208921.1 Length = 246 Score = 100 bits (248), Expect = 4e-26 Identities = 81/202 (40%), Positives = 103/202 (50%), Gaps = 14/202 (6%) Query: 23 ISGEKYSRAVATAAKGLPVLIPSLADLFPPSDILDALDGILLTGSPSNVEPFHYQGPASA 82 +S Y AV A GLPV++ L ++ LDG++LTG +++P Y Sbjct: 29 VSPVSYHEAVWRAG-GLPVMLAPLPGAVDA--VIALLDGLVLTGG-RDLDPARYGAEPEP 84 Query: 83 PGTAHDPARDATTLPLIRAAVDAGIPVLGICRGFQEMNVAFGGSLHQKVHE-VGTFIDHR 141 RD L L AA + +PVLGICRG Q +NVA GG+LHQ + VGT + Sbjct: 85 HTVVAHRLRDQWELALFTAAQERCLPVLGICRGMQLINVALGGTLHQHLPAVVGTDVHSP 144 Query: 142 EDDTQAVDVQYGPAHAVHIQPGGVLAGLGLPQRIEVNSIHSQGIERLAPGLRAEAVAPDG 201 E Q G HAV PG L+ L L QR + + H Q + LAPGL A A A DG Sbjct: 145 EPG------QVG-RHAVITAPGSRLSRL-LGQRRVMPTHHHQAVRELAPGLCATAWAEDG 196 Query: 202 LIEAVSVPGGKAFALGVQWHPE 223 +IE V G A+ LGVQ HPE Sbjct: 197 VIEGVEGTGA-AWLLGVQGHPE 217 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 246 Length adjustment: 24 Effective length of query: 234 Effective length of database: 222 Effective search space: 51948 Effective search space used: 51948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory