Align ATPase (characterized, see rationale)
to candidate WP_110207539.1 DNK54_RS13505 ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_003194585.1:WP_110207539.1 Length = 330 Score = 149 bits (375), Expect = 1e-40 Identities = 90/222 (40%), Positives = 132/222 (59%), Gaps = 6/222 (2%) Query: 37 ALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDRRDIATI 96 A+ GVSL V+RGE++ ++GPSG GKST LR + LE G + +G L+ + T Sbjct: 16 AVDGVSLRVERGEILAVLGPSGCGKSTLLRAVAGLEPPAAGCVRADGEDLAR----VPTH 71 Query: 97 RQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYPG 156 R+ ++FQ LF TV N+ P+++RR P A+ +LLE V ++ A++ P Sbjct: 72 RRGFALMFQDGQLFNQKTVAGNVGY-PLRIRRRPRAEVRDRVAELLELVGLSAYAERRPD 130 Query: 157 QLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRD-LASEGMTMLVATH 215 LSGG++QRVA+ARALA++PR+LL DEP SALD + + +R+ L + G T L+ TH Sbjct: 131 SLSGGERQRVALARALAVEPRLLLLDEPLSALDAALRDRLAGELREILTAAGTTALLVTH 190 Query: 216 EVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFL 257 + A VADR+ LM G++V+ P + AP A FL Sbjct: 191 DHEEAFAVADRMALMRAGRVVQSGTPADVWAAPVDAEAADFL 232 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 330 Length adjustment: 26 Effective length of query: 235 Effective length of database: 304 Effective search space: 71440 Effective search space used: 71440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory