Align Sodium:dicarboxylate symporter (characterized, see rationale)
to candidate WP_110205280.1 DNK54_RS02110 dicarboxylate/amino acid:cation symporter
Query= uniprot:A1S570 (437 letters) >NCBI__GCF_003194585.1:WP_110205280.1 Length = 456 Score = 233 bits (594), Expect = 9e-66 Identities = 146/429 (34%), Positives = 225/429 (52%), Gaps = 24/429 (5%) Query: 14 KILIGMGAGILIGLLLRNFFGGSEWVQD------YITEGFFHVIGTIFINSLKMLVVPLV 67 ++LIG+ G+++GL+ R G + V D ++TE V G+ F+ L+ +V PLV Sbjct: 23 QVLIGLALGVVLGLVARQM--GPDGVHDGVVDPNWLTETLTKV-GSTFVTLLRTVVPPLV 79 Query: 68 FISLVCGTCSLSEPSKLGRLGGKTLAFYLFTTAIALVVAISAAVLVQPGNASLASESMQY 127 F+++V +L E + RL KTL ++ T +A+ + I +++QPGN + +E Sbjct: 80 FLAIVASIANLREVTGAARLAWKTLMWFAITALVAVSIGIVLGLVLQPGNHTSVTEEAAT 139 Query: 128 SAKEAPSLADVLINIVPSNPMKALSEG-----------NMLQIIIFAVIFGFAISHIGER 176 + S D L +VP+N M L G N+LQI++ A+ G A +G+ Sbjct: 140 APGTQGSWLDFLTGLVPAN-MLGLEAGAKPDGSIGLSFNVLQILVMAIAVGIATLKVGDA 198 Query: 177 GRRVAALFDDLNEVIMRVVTLIMQLAPYGVFALMGKLALTLGMETLESVIKYFMLVLVVL 236 V+ +V+ I+ LAP L+G + G + L S+ + + + L Sbjct: 199 AEPFLGFVRSALAVVQKVLWWIILLAPIATVGLLGNAVASYGWDALGSLATFSVAIYAGL 258 Query: 237 LFHGFVVYPTLLKLFSGLSPLMFIRKMRDVQLFAFSTASSNATLPVTMEASEHRLGADNK 296 VVYP LL+ + LS F AF + SS T+PVT +E LG Sbjct: 259 ALVLLVVYPVLLRA-NDLSVKQFFSGAWPAISLAFVSRSSIGTMPVTEAVTERNLGVPRA 317 Query: 297 VASFTLPLGATINMDGTA-IMQGVATVFIAQVFGIDLTITDYAMVVMTATLASIGTAGVP 355 ASF +PLGAT MDG A I ++ +F+AQ FG+DL+ITDY ++ + + S TAGV Sbjct: 318 YASFAVPLGATTKMDGCASIYPAISAIFVAQFFGLDLSITDYLLIAFVSVIGSAATAGVT 377 Query: 356 GVGLVMLAMVLNQVGLPVEGIALILGVDRMLDMVRTAVNVTGDTVATVVIAKSEGALNEA 415 G VML + L+ +GLP+EG+ L+L +D +LDM RTAVNV G + ++AK EG L+ Sbjct: 378 GA-TVMLTLTLSTLGLPLEGVGLLLAIDPILDMGRTAVNVAGQALVPTIVAKREGILDLD 436 Query: 416 VFNDPKAGK 424 + P+ GK Sbjct: 437 AYTAPRGGK 445 Lambda K H 0.325 0.139 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 456 Length adjustment: 33 Effective length of query: 404 Effective length of database: 423 Effective search space: 170892 Effective search space used: 170892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory