Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 228 bits (581), Expect = 2e-64 Identities = 137/345 (39%), Positives = 200/345 (57%), Gaps = 18/345 (5%) Query: 3 SSLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTE 62 +S+++ I K +G S +L +D+ + GEFL L+G SG GKSTLLNIIAG + Sbjct: 14 ASIEVDRIRKVYG----STTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADG 69 Query: 63 GEIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEV 122 G++R+ GK++ +P R + MVFQ YAL+P +SV DN+ + L PK E + + Sbjct: 70 GDVRVDGKSITSVPAHKRGLGMVFQHYALFPHMSVYDNVAYGLRRHGFPKAEIPGLVADA 129 Query: 123 AAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIK 182 M+++ HL RRP++LSGGQ+QRVA+ RA+ +P++ L DEPL LD LR +++ EI+ Sbjct: 130 LEMVEMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIR 189 Query: 183 RLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFIGSP 242 RLH+ GIT V+VTHDQ EA+T+ RIA+++ G + QLGTP+E+Y+ P+ Y A FIG Sbjct: 190 RLHKEMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCRYAAEFIG-- 247 Query: 243 TMNLLRGAVTGGQFGIQGAALNLAPPPSSANEVLLGVRPEHLVMQ--ETAP------WRG 294 N++ G+ G F +A+ +L VRPE L + + P Sbjct: 248 VSNIMTGSRAGDVFTDTRNQTTHKVSGGAADGTVLMVRPERLRVSAGQVGPAGHENALPA 307 Query: 295 RVSVVEPTGPDTYVMVDTAAG-SVTLRTD---AQTRVQPGEHVGL 335 VS G D V V TA+G + RT+ +QPG V L Sbjct: 308 IVSDCVYLGSDRTVHVRTASGEEMVARTEVPRTDDGIQPGVPVTL 352 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 368 Length adjustment: 29 Effective length of query: 326 Effective length of database: 339 Effective search space: 110514 Effective search space used: 110514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory