Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 220 bits (561), Expect = 4e-62 Identities = 122/289 (42%), Positives = 179/289 (61%), Gaps = 8/289 (2%) Query: 2 SALEIRNIRKRYGEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDIL 61 +++E+ IRK YG L ID+ + +GEFL LLG+SG GKSTLLNIIAG + GGD+ Sbjct: 14 ASIEVDRIRKVYGSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGDVR 73 Query: 62 IGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARLL 121 + +S+ V R + MVFQ YAL+P++SV N+ +GL P+AE V D ++ Sbjct: 74 VDGKSITSVPAHKRGLGMVFQHYALFPHMSVYDNVAYGLRRHGFPKAEIPGLVADALEMV 133 Query: 122 QIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLHQ 181 ++ +L R+P++LSGGQ+QRVA+ RA+V P+V L DEPL LD LR +++ E++RLH+ Sbjct: 134 EMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIRRLHK 193 Query: 182 MLRTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPPMNI 241 + T V+VTHDQ EA+T++ RIA++ G I QL P+E+YD P+ Y A F+G NI Sbjct: 194 EMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCRYAAEFIG--VSNI 251 Query: 242 LDAEMTANGLKIEGCEEVLPLPAAFNGAAWAGRRVKVGIRPEALRLAAG 290 + + + + +G A G + V RPE LR++AG Sbjct: 252 MTGSRAGDVFTDTRNQTTHKV----SGGAADGTVLMV--RPERLRVSAG 294 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 368 Length adjustment: 29 Effective length of query: 331 Effective length of database: 339 Effective search space: 112209 Effective search space used: 112209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory