Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02121 (258 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 149 bits (377), Expect = 6e-41 Identities = 85/232 (36%), Positives = 135/232 (58%), Gaps = 8/232 (3%) Query: 15 TDVAIEITNMNKWYGDFHVLRDINLRVMRGERIVVAGPSGSGKSTMIRCINRLEEHQKGK 74 T +IE+ + K YG +L DI+L + GE + + G SGSGKST++ I + G Sbjct: 12 TGASIEVDRIRKVYGSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGD 71 Query: 75 IVVDGIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKEAEQVA 134 + VDG +T+ + +R +GMVFQH+ LFPH+++ +N + PK E + Sbjct: 72 VRVDGKSITS----VPAHKRGLGMVFQHYALFPHMSVYDNVAYG-LRRHGFPKAEIPGLV 126 Query: 135 MHFLERVKIPEQALKYPGQLSGGQQQRVAIARSLCMRPKILLFDEPTSALDPEMVKEVLD 194 LE V++ + P +LSGGQQQRVA+AR++ RP++LL DEP ALD +M++E L Sbjct: 127 ADALEMVEMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALD-KMLREQLQ 185 Query: 195 TMVGL--AEEGMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPAEFFDNP 244 + E G+T + VTH+ A +++R+ +++G IV+ +P E +D P Sbjct: 186 LEIRRLHKEMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAP 237 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 368 Length adjustment: 27 Effective length of query: 231 Effective length of database: 341 Effective search space: 78771 Effective search space used: 78771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory