Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate WP_110204949.1 DNK54_RS00125 electron transfer flavoprotein subunit alpha/FixB family protein
Query= BRENDA::Q18AQ5 (336 letters) >NCBI__GCF_003194585.1:WP_110204949.1 Length = 313 Score = 175 bits (444), Expect = 1e-48 Identities = 112/330 (33%), Positives = 179/330 (54%), Gaps = 19/330 (5%) Query: 1 MGNVLVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHYGADE 60 M +LV+++ + ++ +LELL A + + SA+ +GS + + LA +GA++ Sbjct: 1 MAEILVLVDHVDGAVKKPTLELLTIARRLGEP-----SAVFIGSG-DAPAEALAKFGAEK 54 Query: 61 VIVVDDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADC 120 V VDD + Y P + + ++ VL +++ G+++A R++ +I +GL D Sbjct: 55 VYAVDDAQIKGYLVAPKAEVLQQLVEKTSAGAVLIPSSAEGKEIAARLAIKIDSGLITDA 114 Query: 121 TGLAVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEA-VINR 179 + T T+ F G+ P + TV+P P+E A + Sbjct: 115 VDVQAGPVT-----TQSVFAGSYTVQAKVTKGTP-IITVKPN---SAAPEEAAGAGAVEA 165 Query: 180 FKVEFNDADKLVQVV-QVIKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIGGE 238 F +DA K Q+V +++ + ++ +A I+VS GRG GG + + LA+ +G Sbjct: 166 FAPTISDAAKAAQIVASQPRQSTGRPELTEAAIVVSGGRGTGG--DFSAVEALADSLGAA 223 Query: 239 VSGSRATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNPE 298 V SRA +D+GW QVGQTGKTV P LY+A GISGAIQH AGM+ ++ IVA+NK+ E Sbjct: 224 VGASRAAVDSGWKPHTFQVGQTGKTVSPQLYVANGISGAIQHRAGMQTSKTIVAVNKDEE 283 Query: 299 APIFKYADVGIVGDVHKVLPELISQLSVAK 328 APIF+ D G+VGD+H VLP L +++ K Sbjct: 284 APIFELVDFGVVGDLHTVLPALTEEINKRK 313 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 313 Length adjustment: 28 Effective length of query: 308 Effective length of database: 285 Effective search space: 87780 Effective search space used: 87780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory