Align Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= SwissProt::P19566 (369 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 222 bits (566), Expect = 1e-62 Identities = 108/234 (46%), Positives = 158/234 (67%) Query: 2 ASVQLRNVTKAWGDVVVSKDINLDIHDGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 61 AS+++ + K +G + DI+LDI GEF+ +G SG GKSTLL +IAG GD+ Sbjct: 14 ASIEVDRIRKVYGSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGDVR 73 Query: 62 IGETRMNDIPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVMNQRVNQVAEVL 121 + + +P +RG+GMVFQ YAL+PH+SV +N+++GL+ G K + V E++ Sbjct: 74 VDGKSITSVPAHKRGLGMVFQHYALFPHMSVYDNVAYGLRRHGFPKAEIPGLVADALEMV 133 Query: 122 QLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQMRIEISRLHK 181 ++ HL +R+P LSGGQ+QRVA+ R +V PRV L+DEPL LD LR Q+++EI RLHK Sbjct: 134 EMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIRRLHK 193 Query: 182 RLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIG 235 +G T ++VTHDQ EA+T++D+I +L+ G + Q+G P ELY P+ R+ A FIG Sbjct: 194 EMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCRYAAEFIG 247 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 368 Length adjustment: 30 Effective length of query: 339 Effective length of database: 338 Effective search space: 114582 Effective search space used: 114582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory