Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 191 bits (485), Expect = 3e-53 Identities = 100/213 (46%), Positives = 139/213 (65%) Query: 25 NLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIAMVFQ 84 +L+I GEFL L+G SG GKST L ++AG G + + K +T V R + MVFQ Sbjct: 35 DLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGDVRVDGKSITSVPAHKRGLGMVFQ 94 Query: 85 NYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQRQRV 144 +YAL+PHM+V +N+ + L+ G + EI V +A + + +R+P LSGGQ+QRV Sbjct: 95 HYALFPHMSVYDNVAYGLRRHGFPKAEIPGLVADALEMVEMGHLGKRRPAELSGGQQQRV 154 Query: 145 AMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEALTMGD 204 A+ RA+V P+V LMDEPL LD LR Q + +I L +++G+T V+VTHDQ EALTM D Sbjct: 155 ALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIRRLHKEMGITFVFVTHDQEEALTMSD 214 Query: 205 RIAVLKDGYLQQVGAPRELYDRPANVFVAGFIG 237 RIA+L+ G + Q+G P ELYD P+ + A FIG Sbjct: 215 RIALLEKGDIVQLGTPEELYDAPSCRYAAEFIG 247 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 368 Length adjustment: 30 Effective length of query: 346 Effective length of database: 338 Effective search space: 116948 Effective search space used: 116948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory