Align ABC transporter for D-mannitol and D-mannose, ATPase component (characterized)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_25895 (367 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 230 bits (586), Expect = 5e-65 Identities = 132/332 (39%), Positives = 195/332 (58%), Gaps = 17/332 (5%) Query: 2 AHLKIKNLQKGFEGFSIIKGIDLEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVTAGTIE 61 A +++ ++K + +I+ IDL++ EF+ +G SG GKSTLL +IAG + G + Sbjct: 14 ASIEVDRIRKVYGSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGDVR 73 Query: 62 LDGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVNKAEVEKKVNEAARIL 121 +DG+ IT V KR L MVFQ YAL+PHMSV N+++ L G KAE+ V +A ++ Sbjct: 74 VDGKSITSVPAHKRGLGMVFQHYALFPHMSVYDNVAYGLRRHGFPKAEIPGLVADALEMV 133 Query: 122 ELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLHK 181 E+G + +R+P +LSGGQ+QRVA+ RA+V P++ L DEPL LD LR Q++LE+ RLHK Sbjct: 134 EMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIRRLHK 193 Query: 182 ELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPLELYHQPANLFVAGFLGTPKMGF 241 E+ T ++VTHDQ EA+T++D++ +L G I Q+G+P ELY P+ + A F+G + Sbjct: 194 EMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCRYAAEFIGVSNI-- 251 Query: 242 LKGKVTRVERQNCEVLLDAGTRITLPLSGANLSIGGAVTLGIRPEHLNLAL----PGDCT 297 + +V D + T +SG L +RPE L ++ P Sbjct: 252 ------MTGSRAGDVFTDTRNQTTHKVSG---GAADGTVLMVRPERLRVSAGQVGPAGHE 302 Query: 298 LQVTADVSE--RLGSDTFCHVLTASGEALTMR 327 + A VS+ LGSD HV TASGE + R Sbjct: 303 NALPAIVSDCVYLGSDRTVHVRTASGEEMVAR 334 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 368 Length adjustment: 30 Effective length of query: 337 Effective length of database: 338 Effective search space: 113906 Effective search space used: 113906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory