Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_110208105.1 DNK54_RS16590 ABC transporter ATP-binding protein
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_003194585.1:WP_110208105.1 Length = 263 Score = 202 bits (513), Expect = 7e-57 Identities = 111/249 (44%), Positives = 156/249 (62%), Gaps = 12/249 (4%) Query: 5 LLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFEL 64 LL++ DV RFGG+ A+N T + +I GLIGPNGAGKTT FNVITGL +P +G+ Sbjct: 3 LLEVNDVVVRFGGVTAVNQARFTADERRITGLIGPNGAGKTTCFNVITGLQRPTSGSVRF 62 Query: 65 DGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAAR 124 G+ + +A H A+ G+ARTFQ + FG +TV +NV V + FG + R +AR Sbjct: 63 GGRDVTRTAVHRRARRGMARTFQRLEAFGSLTVRDNVRVALDIA---GGFGGLMRSSSAR 119 Query: 125 EEEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAGM 184 +EA LD VGI ++A A + G R LE+AR L DP+LL LDEP++G+ Sbjct: 120 VDEA---------LDRVGISEYAAERADSIPTGTARLLELARCLVGDPKLLLLDEPSSGL 170 Query: 185 NATEKLGLRELLVKIQAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQKNP 244 + +E ELL+ + +EGK IL++EHD+ L+M +C+ I VLD+G+ I G PA+V+ + Sbjct: 171 DESETDAFGELLIALASEGKAILMVEHDMDLVMTVCDDIHVLDFGEIICSGSPAEVRADA 230 Query: 245 AVIEAYLGA 253 V AYLGA Sbjct: 231 RVQAAYLGA 239 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 263 Length adjustment: 24 Effective length of query: 231 Effective length of database: 239 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory