Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 172 bits (435), Expect = 2e-47 Identities = 96/275 (34%), Positives = 150/275 (54%), Gaps = 6/275 (2%) Query: 32 EQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVD 91 ++I + G + + D L I GE ++G SGSGKST++ ++ I+ G V +DG Sbjct: 19 DRIRKVYGSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGDVRVDGKS 78 Query: 92 IAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQ 151 I + ++ + MVFQ +AL PHM+V DN A+G+ G E DAL Sbjct: 79 ITSVP------AHKRGLGMVFQHYALFPHMSVYDNVAYGLRRHGFPKAEIPGLVADALEM 132 Query: 152 VGLENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQ 211 V + + P ELSGG +QRV LARA+ P +LLMDE ALD ++R ++Q E+ +L Sbjct: 133 VEMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIRRLH 192 Query: 212 AKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDIS 271 + T VF++HD +EA+ + DRIA+++ G++VQ+GTP+E+ + P+ Y F +I Sbjct: 193 KEMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCRYAAEFIGVSNIM 252 Query: 272 QVFSAKDIARRTPNGLIRKTPGFGPRSALKLLQDE 306 A D+ T N K G + +++ E Sbjct: 253 TGSRAGDVFTDTRNQTTHKVSGGAADGTVLMVRPE 287 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 368 Length adjustment: 30 Effective length of query: 370 Effective length of database: 338 Effective search space: 125060 Effective search space used: 125060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory