Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= uniprot:P40735 (281 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 125 bits (315), Expect = 1e-33 Identities = 76/207 (36%), Positives = 120/207 (57%), Gaps = 4/207 (1%) Query: 25 LDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRKK 84 L+ + L + GE+L ++G +GSGKSTL + G I + GD+ V G +T SV ++ Sbjct: 31 LNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGDVRVDGKSIT--SVPAHKRG 88 Query: 85 IGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLS 144 +GMVFQ+ F +V D+VA+GL +G P+ E+ V A++ V M + P LS Sbjct: 89 LGMVFQHYA-LFPHMSVYDNVAYGLRRHGFPKAEIPGLVADALEMVEMGHLGKRRPAELS 147 Query: 145 GGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLN 204 GGQ+QRVA+A + RP ++++DE LD + RE++ +R L ++ T + +THD Sbjct: 148 GGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIRRLHKEMGITFVFVTHDQE 207 Query: 205 EA-AKADRIIVMNGGKKYAEGPPEEIF 230 EA +DRI ++ G G PEE++ Sbjct: 208 EALTMSDRIALLEKGDIVQLGTPEELY 234 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 368 Length adjustment: 28 Effective length of query: 253 Effective length of database: 340 Effective search space: 86020 Effective search space used: 86020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory