Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate WP_110206636.1 DNK54_RS08955 thiolase family protein
Query= metacyc::MONOMER-3207 (400 letters) >NCBI__GCF_003194585.1:WP_110206636.1 Length = 392 Score = 305 bits (780), Expect = 2e-87 Identities = 181/398 (45%), Positives = 241/398 (60%), Gaps = 12/398 (3%) Query: 4 VFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQAGED 63 + I D RTPIG FGG L V A +L AV + + V+ +Q+ EV G Q G D Sbjct: 6 IVIVDGARTPIGSFGGVLKDVPAHELGAVAVTEALS-RAGVRGEQIREVVMGQIGQVGPD 64 Query: 64 NRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESMSRA 123 N R+AL AGLP+S+P T+NRLC SG+ AI +A + ++ AI GG ESMSR Sbjct: 65 AYNARRVALA-AGLPQSVPAYTVNRLCGSGLQAIWSAAMEMRWNNLDFAIGGGDESMSRM 123 Query: 124 PFVMGKAESGYSRNMK-LEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRADQD 182 PF+ A +GY + L D T+G +P GV TA+NVA Y V R QD Sbjct: 124 PFLDFGARNGYKLGDRALVDGTVGM-LTDPFSNKHMGV-----TAENVAAKYGVDRVQQD 177 Query: 183 AFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIVERDEHLRPETTLEALTKLKPVNG 242 FA+ SQ++AA +A FAEEIVPV +A +K T VE DEH +P TT+E L KL+ Sbjct: 178 EFAVESQRRAATDEAKAAFAEEIVPVEVAGRKPYT-VEVDEHPKPGTTMETLGKLRAAFV 236 Query: 243 PDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPVPAV 302 D +VTAGNASG+NDGA A++LA+ A +HGL+P + +++G + P +MG PV A+ Sbjct: 237 KDGSVTAGNASGINDGAGAVVLATEAAAAEHGLSPLVSIEAVSTGAMEPELMGYAPVLAL 296 Query: 303 RKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGMSG 362 + L ER G+ D IELNEAFASQ +AV R+ G+ D QVNP GGAIALGHP+G +G Sbjct: 297 KDLFERTGLTPKDIGTIELNEAFASQAVAVSRDAGL--DPAQVNPYGGAIALGHPVGATG 354 Query: 363 ARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400 A L + A + ++ G+ TMC+G GQ LA +R+ Sbjct: 355 AILSVRAAKTMVRNDLEFGIVTMCIGGGQALAALFKRI 392 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 392 Length adjustment: 31 Effective length of query: 369 Effective length of database: 361 Effective search space: 133209 Effective search space used: 133209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory