Align 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized)
to candidate WP_110208307.1 DNK54_RS17595 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-15108 (486 letters) >NCBI__GCF_003194585.1:WP_110208307.1 Length = 492 Score = 378 bits (971), Expect = e-109 Identities = 194/466 (41%), Positives = 284/466 (60%), Gaps = 5/466 (1%) Query: 14 FIDGKFVPSLDGKTFDNINPATEEKLGTVAEGGAAEIDLAVQAAKKALNGPWKKMTANER 73 FI G+FV + DG TF+ I+P L VAE AA++D AV AA A W +M A +R Sbjct: 6 FIGGEFVDAADGGTFETIDPHDGTVLANVAEARAADVDRAVAAAASAFPA-WSRMAAADR 64 Query: 74 IAVLRKVGDLILERKEELSVLESLDTGKPTWLSGSIDIPRAAYNFHFFSDYIRTITNEAT 133 +L ++ D I + + L++LE+ DTG P + +D+PR A F +F Sbjct: 65 GRLLLRLADAIEDDVDALALLETRDTGHPVRDTRGLDVPRTAATFRYFGGMADKFQGSVV 124 Query: 134 QMDDVALNYAIRRPVGVIGLINPWNLPLLLMTWKLAPALAAGNTVVMKPAELTPMTATVL 193 ++ L+Y + P+GV+G I PWN P++ +WK+ PALAAGN VVMKP+E++P++A + Sbjct: 125 PVEQGFLDYVVPEPLGVVGQIVPWNFPVMFTSWKMGPALAAGNCVVMKPSEISPLSALRV 184 Query: 194 AEICRDAGVPDGVVNLVHGFGPNSAGAALTEHPDVNAISFTGETTTGKIIMASAAKTLKR 253 AE+ + G P GV+N+V GFG +AGA + +HP + ISFTG T G+ I SAA +LK+ Sbjct: 185 AELAAEVGFPPGVINMVPGFGA-TAGARIVDHPAIAKISFTGSTAVGQSIARSAADSLKQ 243 Query: 254 LSYELGGKNPNVIFADSNLDEVIETTMKSSFINQGEVCLCGSRIYVERPAYEAFLEKFVA 313 + ELGGK N++F D+++ + T F NQG+ C+ SR+ V + FLE+ + Sbjct: 244 VHLELGGKGANIVFDDADMAAAVNGTAFGIFHNQGQACIAASRLIVHEAVKDEFLERLIT 303 Query: 314 KTKELVVGDPFDAKTKVGALISDEHYERVTGYIKLAVEEGGTILTGGKRPE--GLEKGYF 371 T+ + +GDP D T++G L S +H +RV ++ L EEGGT+LTGG P+ L G++ Sbjct: 304 LTRSIRLGDPKDPATEMGPLTSSQHRDRVMSHLALTEEEGGTVLTGGHAPQDRALADGFY 363 Query: 372 LEPTIITGLTRDCRVVKEEIFGPVVTVIPFDTEEEVLEQINDTHYGLSASVWTNDLRRAH 431 +EPTI+ + D R +EE+FGP + V F TE+E L ND YGL +WT DL RAH Sbjct: 364 VEPTIVETVP-DSRAAQEEVFGPFMVVHAFKTEDEALRIANDVAYGLGGGLWTRDLSRAH 422 Query: 432 RVAGQIEAGIVWVNTWFLRDLRTPFGGMKQSGIGREGGLHSFEFYS 477 RVA + AG+VWVN++ + +PFGG+ SG GRE G + Y+ Sbjct: 423 RVARDLRAGMVWVNSYKRVNPGSPFGGVGVSGYGREMGFEAMREYT 468 Lambda K H 0.318 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 627 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 492 Length adjustment: 34 Effective length of query: 452 Effective length of database: 458 Effective search space: 207016 Effective search space used: 207016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory