Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_110205408.1 DNK54_RS02835 acetyl-CoA C-acetyltransferase
Query= BRENDA::Q0K368 (391 letters) >NCBI__GCF_003194585.1:WP_110205408.1 Length = 386 Score = 417 bits (1071), Expect = e-121 Identities = 215/393 (54%), Positives = 281/393 (71%), Gaps = 9/393 (2%) Query: 1 MAEAYIVAAVRTAGGRKGGKLSGWHPADLAAQVLDALVERTGADPALVEDVIMGCVSQVG 60 MAEAYIV AVRT G++GG L+ H ADL A L AL++RTG DPA V+DVIMGC +G Sbjct: 1 MAEAYIVDAVRTPVGKRGGALAAMHSADLGAHSLAALMQRTGVDPAAVDDVIMGCCDTIG 60 Query: 61 EQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGAMDIVIAAGVESMT 120 QAG+VAR A L + LP+ VPG ++DRQCGSSQQ++HFAAQ VMSG D+V+A G+++M+ Sbjct: 61 SQAGDVARTAWLVAGLPDHVPGVTIDRQCGSSQQSVHFAAQGVMSGTQDLVVAGGLQNMS 120 Query: 121 RVPMGLSSQLPAKNGFGVP--KSPGIEARYPGVQFSQFTGAEMIARKYDLSREQLDAYAL 178 +P+ + + + GF P +SPG ARY V+ SQF AEMIA K+DLSRE+++ +AL Sbjct: 121 AIPISSAMLVAQQYGFSTPFAESPGWVARYGDVEVSQFNSAEMIAEKWDLSREEMERFAL 180 Query: 179 QSHQRAIAATKSGRFTAEILPVEVRTADGANGEMHTTDEGVRYDATLESIGSVKLIAEGG 238 +SH RA A GRF AEI PVE+ +G + TD+ R D +LE + + + GG Sbjct: 181 ESHTRAKQAIAEGRFKAEIAPVEI------DGTLFDTDQCPR-DTSLEKMAGLDPLQPGG 233 Query: 239 RVTAASASQICDGAAGLMVVNEAGLKKLGVKPLARVHAMTVIGHDPVVMLEAPLPATEVA 298 R+TA ASQICDG+A L++ +E +K G+ P AR+H ++V G DP+ ML P+ AT+ A Sbjct: 234 RITAGVASQICDGSAALLIASEQAVKDHGLTPRARIHHISVRGDDPIWMLTGPIRATQYA 293 Query: 299 LKKAGLRIGDIDLFEVNEAFAPVPLAWLKATGADPARLNVHGGAIALGHPLGGSGAKLMT 358 L+K G+ I DIDLFE NEAFA V LAW+K TGA ++NV+GG IALGHP+G +GA+LMT Sbjct: 294 LEKTGMSIDDIDLFECNEAFASVVLAWMKETGAPHDKVNVNGGGIALGHPIGATGARLMT 353 Query: 359 TLVHALHTHGKRYGLQTMCEGGGLANVTIVERL 391 TL++ L G RYGLQTMCEGGG ANVTI+ERL Sbjct: 354 TLLNELERTGGRYGLQTMCEGGGQANVTIIERL 386 Lambda K H 0.317 0.132 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 386 Length adjustment: 30 Effective length of query: 361 Effective length of database: 356 Effective search space: 128516 Effective search space used: 128516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory