Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_110208787.1 DNK54_RS19555 crotonase/enoyl-CoA hydratase family protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_4790 (356 letters) >NCBI__GCF_003194585.1:WP_110208787.1 Length = 264 Score = 107 bits (268), Expect = 3e-28 Identities = 66/177 (37%), Positives = 95/177 (53%), Gaps = 6/177 (3%) Query: 9 LAEVRNHIGHLTLNRPAGLNAITLDMVRSLQQQLDAWAQDPQVHAVVLRGAGEKAFCAGG 68 L EVR HI +TLNRP +N++ + L LD QDP+V AVV+ G +AFCAG Sbjct: 10 LYEVRGHIAVITLNRPEAMNSVNRSLATGLGHGLDRAEQDPEVRAVVVTATG-RAFCAGM 68 Query: 69 DIRSLYDSFKSGDTLHEDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADLRV 128 D+++ F G+ + + E + H KPV+A ++GF +GGG +V ADL V Sbjct: 69 DLKA----FARGEDVSVEGHAEWGFAGMVRHPISKPVIAAVNGFAMGGGTEIVLAADLAV 124 Query: 129 VTERSRLAMPEVAIGYFPDVGGSHFLPR-VPGELGIYLGVSGVQIRAADALYCGLAD 184 E + +PEV G GG LPR +P L + L ++G + AA+A GL + Sbjct: 125 AAESASFGLPEVKRGLVAAAGGVLRLPRQIPIRLAMELALTGRAVTAAEAAEIGLVN 181 Lambda K H 0.322 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 264 Length adjustment: 27 Effective length of query: 329 Effective length of database: 237 Effective search space: 77973 Effective search space used: 77973 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory