Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_110206994.1 DNK54_RS11055 ABC transporter ATP-binding protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_003194585.1:WP_110206994.1 Length = 368 Score = 116 bits (290), Expect = 7e-31 Identities = 72/233 (30%), Positives = 131/233 (56%), Gaps = 11/233 (4%) Query: 2 LSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYE 61 + D++ YG L+D+ ++++ GE +TL+GA+G+GKSTLL + G +A G +R + Sbjct: 16 IEVDRIRKVYGSTTILNDIDLDIRAGEFLTLLGASGSGKSTLLNIIAGFIKADGGDVRVD 75 Query: 62 GEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMG----GFFTDKDDYQVQMDKVL 117 G+ + +P+ ++ + +V + +F ++V +N+A G GF K + + L Sbjct: 76 GKSITSVPAH---KRGLGMVFQHYALFPHMSVYDNVAYGLRRHGF--PKAEIPGLVADAL 130 Query: 118 ELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIE 177 E+ + ++R +SGG+QQ +A+ RA++ +P++LL+DEP L ++ +Q+ I Sbjct: 131 EMV-EMGHLGKRRPAELSGGQQQRVALARAVVFRPRVLLMDEPLGALDKMLREQLQLEIR 189 Query: 178 QLRRE-GVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDA 229 +L +E G+T V + +AL ++DR +LE G IV T L P R A Sbjct: 190 RLHKEMGITFVFVTHDQEEALTMSDRIALLEKGDIVQLGTPEELYDAPSCRYA 242 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 368 Length adjustment: 26 Effective length of query: 207 Effective length of database: 342 Effective search space: 70794 Effective search space used: 70794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory