Align long-chain-aldehyde dehydrogenase (EC 1.2.1.48) (characterized)
to candidate WP_110753777.1 C7477_RS15455 coniferyl aldehyde dehydrogenase
Query= BRENDA::P51648 (485 letters) >NCBI__GCF_003217235.1:WP_110753777.1 Length = 458 Score = 275 bits (704), Expect = 2e-78 Identities = 158/426 (37%), Positives = 233/426 (54%), Gaps = 8/426 (1%) Query: 5 VRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLC-KSEFNVYSQEVIT 63 ++R R+AF L R +L + R+++E + + A++ D +S E+ Sbjct: 2 LKRQREAFDEEMHPSLEVRRDRLNRIGRLLKENQAALCEAVSRDFGHRSHHETIQLEIAP 61 Query: 64 VLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLI 123 ++G + L W+ + +++ + ++Q QPLGV+ I+ WNYP +L + PLI Sbjct: 62 LMGALRHTRARLRRWMKPERRSRSLEFLQFSNWVQYQPLGVIGIMVPWNYPLLLALGPLI 121 Query: 124 GAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFY 183 +AAGN +IKPSEL T+ +LA+L Y + V GGVE FDH+ + Sbjct: 122 DILAAGNRAMIKPSELLPVTSALLARLAGTYFKPEEVAVTEGGVETAEAFSALPFDHLIF 181 Query: 184 TGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIA 243 TG+TAV + VM AAA++LTP+TLELGGKSP I D + R I +GK MN GQTCIA Sbjct: 182 TGSTAVARKVMAAAAENLTPLTLELGGKSPAIIAPDYPVAQAARDIAFGKLMNAGQTCIA 241 Query: 244 PDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLL-----EGQ 298 PDY+L E S T + FY E+ Y ++ R R++ + G Sbjct: 242 PDYVLIERSKLETFAAAFIATAETFYPRQSGET-HYTSLVGERAHDRLMRGIGECRARGV 300 Query: 299 KIAFGGETDEATR-YIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREK 357 K+ G A +I PT++ D +M+EEIFGP+LP++P + D A+ FI ER + Sbjct: 301 KLMSAGIALPAKGVHIPPTLVIDPPADCLLMEEEIFGPVLPLIPYDDFDAALKFIRERPR 360 Query: 358 PLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFD 417 PLALY+F+ + + ++ + T SG VT N ++H N PFGG+G SG+GAYHG F Sbjct: 361 PLALYLFTCDKAIEEKALRNTISGNVTVNGTLLHIAQNDLPFGGIGPSGIGAYHGHEGFK 420 Query: 418 TFSHQR 423 FSH R Sbjct: 421 RFSHAR 426 Lambda K H 0.321 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 458 Length adjustment: 33 Effective length of query: 452 Effective length of database: 425 Effective search space: 192100 Effective search space used: 192100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory