Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate WP_110750441.1 C7477_RS06855 glucose 1-dehydrogenase
Query= SwissProt::A3LZU7 (258 letters) >NCBI__GCF_003217235.1:WP_110750441.1 Length = 249 Score = 124 bits (312), Expect = 1e-33 Identities = 92/256 (35%), Positives = 126/256 (49%), Gaps = 18/256 (7%) Query: 3 GLLNGKVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNV 62 G L+GK+ ITG TG+G A A R GA+V++ +QA L + D Sbjct: 2 GKLDGKIAVITGASTGMGLATAKLFVREGAEVIIT---GRDQAAL----DAAVLDIGKGA 54 Query: 63 LTIPGDISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNG 122 I GDIS + + G +++ +NAGV F E++ E TV IN G Sbjct: 55 EAIRGDISSLADLDALRAHVEARHGRLDILFANAGVGKPGLFEEVSDEDFDFTVGINFKG 114 Query: 123 AFFAIQAAAQQMVKQGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKY 182 FF +Q M GGSII +SI + G A + Y+ TKA + SL +S G Sbjct: 115 TFFTVQKLISLMPA---GGSIILNTSIQGVRGTAGLSVYSATKAALRSLARSLTAEYGPK 171 Query: 183 GIRCNAILPGTIST------ALNEEDLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLAS 236 GIR NA+ PG I T L+EE ++ E + PLGR+G DIA A+FLA+ Sbjct: 172 GIRINALAPGFIDTDIMRRNGLSEEMIR--EMKTQSTAHTPLGRIGTGHDIAKTALFLAT 229 Query: 237 DMSNYVNGAQLLVDGG 252 D S ++ G +L VDGG Sbjct: 230 DESEFITGVELTVDGG 245 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 249 Length adjustment: 24 Effective length of query: 234 Effective length of database: 225 Effective search space: 52650 Effective search space used: 52650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory