Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_110750441.1 C7477_RS06855 glucose 1-dehydrogenase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_003217235.1:WP_110750441.1 Length = 249 Score = 102 bits (255), Expect = 6e-27 Identities = 82/271 (30%), Positives = 128/271 (47%), Gaps = 43/271 (15%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANV------------QMIDIHGGDKHQSSGNYN 54 L KI +TG ++G+GLA + +GA V ++DI G + Sbjct: 4 LDGKIAVITGASTGMGLATAKLFVREGAEVIITGRDQAALDAAVLDIGKGAEAIRG---- 59 Query: 55 FWPTDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEK 114 DISS +++ H+ R GR+D L NAGV P L E+++ F+ Sbjct: 60 ----DISSLADLDALRAHVEARHGRLDILFANAGVGKPGLFE---------EVSDEDFDF 106 Query: 115 MVNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSW 174 V IN KG F Q + M G I+ +S G+ G+ G S Y+ATKAAL S RS Sbjct: 107 TVGINFKGTFFTVQKLISLM--PAGGSIILNTSIQGVRGTAGLSVYSATKAALRSLARSL 164 Query: 175 SKELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNS--IPLGRS 232 + E G GIR+ +APG ++ +R ++ E +RE ++++ PLGR Sbjct: 165 TAEYGPKGIRINALAPGFIDTDIMR----------RNGLSEEMIREMKTQSTAHTPLGRI 214 Query: 233 GRLTEVADFVCYLLSERASYMTGVTTNIAGG 263 G ++A +L ++ + ++TGV + GG Sbjct: 215 GTGHDIAKTALFLATDESEFITGVELTVDGG 245 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 249 Length adjustment: 24 Effective length of query: 243 Effective length of database: 225 Effective search space: 54675 Effective search space used: 54675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory