Align fructokinase; EC 2.7.1.4 (characterized)
to candidate WP_110749833.1 C7477_RS05290 carbohydrate kinase
Query= CharProtDB::CH_006620 (326 letters) >NCBI__GCF_003217235.1:WP_110749833.1 Length = 308 Score = 347 bits (890), Expect = e-100 Identities = 170/275 (61%), Positives = 203/275 (73%) Query: 1 MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIPTAFFTGIADDMMGEI 60 MIL CGEALIDMLPR+T G+ FAP+AGGA+FNTAIA+GRLG P F +G++ D +G+I Sbjct: 1 MILSCGEALIDMLPRETADGQPAFAPHAGGALFNTAIAVGRLGAPAGFLSGLSSDFLGDI 60 Query: 61 LLETLKASNVDYSPCAITPRPSTIAFVKLVNGQATYAFYDEGTAGRMITTADLPDLGDDC 120 L ETL SNVD S C + RP+T+AFV+LVNGQA+YAFYDE TAGRM++ ADLP L D Sbjct: 61 LRETLTRSNVDTSFCVTSDRPTTLAFVRLVNGQASYAFYDENTAGRMLSEADLPQLDDRV 120 Query: 121 EALHFGAISLIPSPCGETYEALLDREAASRVISLDPNIRPGFIKDKPSHMARIKRMAAKS 180 ALHFGAISLIP PCG YE L+ REA RVI LDPNIRPGFI D+ H+ R++RM + Sbjct: 121 TALHFGAISLIPEPCGTAYETLMAREAGRRVIMLDPNIRPGFIADREKHLQRMRRMIPMA 180 Query: 181 DIVKFSDEDLDWFGLQGDHDALAAHWLNHGAKLVVITKGAEGASGYTKDRKVTVPSERVT 240 DIVK SDED+DWF DHD +AA WL G KL++IT+GA GA YT K++VP +V Sbjct: 181 DIVKLSDEDIDWFEEGSDHDRIAADWLTRGPKLIIITRGAAGADAYTARGKISVPGVKVA 240 Query: 241 VVDTVGAGDTFDAGILASLKMDNLLTKRQVASLDE 275 V DTVGAGDT +AG+L L LLTK VA L E Sbjct: 241 VADTVGAGDTVNAGVLVGLHRQGLLTKDAVAGLTE 275 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 308 Length adjustment: 27 Effective length of query: 299 Effective length of database: 281 Effective search space: 84019 Effective search space used: 84019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory