Align alpha-ketoglutarate TRAP transporter, large permease component (characterized)
to candidate WP_110805343.1 C8J30_RS08120 TRAP transporter large permease subunit
Query= reanno::SB2B:6938090 (466 letters) >NCBI__GCF_003217355.1:WP_110805343.1 Length = 441 Score = 160 bits (405), Expect = 8e-44 Identities = 123/469 (26%), Positives = 218/469 (46%), Gaps = 51/469 (10%) Query: 4 ATLFLTLFLCMLLGMPIAIALGFSSMLTILLFSNDSLASVALKLYEATSEHYTLLAIPFF 63 A +F T+ L ML G + A+G +++ L D + + LL +P F Sbjct: 8 ALMFSTMLLMMLTGQRVFGAIGIVAVVAALTLWGDGGTDMGFSAVMKLMKWTALLTLPMF 67 Query: 64 ILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVAAIGSIV 123 + +S +A + +G + GGLA+ +V+ +L +A++G S A +A +I Sbjct: 68 VFMGYVMSETRLAEDLYRMFHVWMGPLPGGLAIGTVLLMVLISAMNGLSVAGMAIGATIA 127 Query: 124 IVGMVRAGYPQKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLIPGLLMG 183 + + R GY + +GVI +LGILIPPS+V+++YA + +++AG++PGLLM Sbjct: 128 LPELQRRGYDKLMISGVIQAGSSLGILIPPSVVLVLYAMIARQPVSNLWLAGIMPGLLMA 187 Query: 184 VLLMVAIYIVARIKNLPSRPFPGVKALSLSSAKAM----GGLALIFIVLGSI---YGGVA 236 L ++ I I + + + ++S A+ GL +FI + + G A Sbjct: 188 ALFILYIIIRTWLNPSLAPRMSAEERAAISRAEKFQLLRAGLLPVFIFVAMMLPFIKGWA 247 Query: 237 SPTEAAAVACVYAYLVAVFGYRDIGPLKEVPWRKEGEAILAAIVRNLLHVGLGLIKTPTD 296 S TE + V LVA W K + +++T T Sbjct: 248 SLTETSVVGVAATVLVA--------------WAKG-------------RMSWYVLETATK 280 Query: 297 KEIRNVVRDGAKVSIMLLFIIANAMLFAHVL----TTERIPHIIAETIVGWGLPPWGFLI 352 + + +++M + II A+ F V I E + GL PW L+ Sbjct: 281 QTL--------LITVMFMMIITAALSFGAVFDGLGAGRSIQTFFTEDL---GLAPWQILV 329 Query: 353 IVNLLLLAAGNFMEPSAILLIMAPILFPIAVQLGIDPIHLGIIMVVNMEIGMLTPPVGLN 412 ++ + L G F++ +A+L+I+AP+ + LG D I G++ + +I LTPP G N Sbjct: 330 LMQVSFLIMGMFLDDTAMLVIVAPVYVSLTKALGYDLIWYGVLYTITCQIAYLTPPFGYN 389 Query: 413 LFVTAGIT--GRSIGWVIHACLPWLLLLLGFLVLITYVPQISLFLPEYL 459 LF+ + ++ + + P++L+++ LVLI PQI+L+LP+ + Sbjct: 390 LFLMKALAPPEYTLPVIYRSVWPFVLVMILTLVLIMVFPQIALWLPQVM 438 Lambda K H 0.329 0.144 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 466 Length of database: 441 Length adjustment: 33 Effective length of query: 433 Effective length of database: 408 Effective search space: 176664 Effective search space used: 176664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory