Align benzoyl-CoA reductase (EC 1.3.7.8) (characterized)
to candidate WP_110803698.1 C8J30_RS00045 CoA activase
Query= BRENDA::Q8VUG0 (301 letters) >NCBI__GCF_003217355.1:WP_110803698.1 Length = 283 Score = 189 bits (479), Expect = 8e-53 Identities = 109/258 (42%), Positives = 164/258 (63%), Gaps = 7/258 (2%) Query: 36 KIITCGIDVGSVSSQAVLVCDGELYGYNSMRTGNNSPDSAKNALQGIMDKIGMKLEDINY 95 K T GID+GS ++AVL+ D E++ + +G ++ D+A ++ ++ + G DI Y Sbjct: 17 KTPTIGIDIGSRQAKAVLLDDAEVHTVITA-SGVDAQDTADRLVKKLLRQSGRDRADIAY 75 Query: 96 VVGTGYGRVNVPFAH---KAITEIACHARGANYMGGNKVRTILDMGGQDCKAIHCD-DKG 151 VVGTGYGR+ + + + +TEI+CHA GA+++ R+I+D+GGQD KAI D D G Sbjct: 76 VVGTGYGRIALGYDDIPTQIVTEISCHAMGAHFLNAG-TRSIIDIGGQDSKAIKVDPDTG 134 Query: 152 KVTNFLMNDKCAAGTGRGMEVISDLMQIPIAELGPRSFDVETEPEAVSSICVVFAKSEAL 211 +V F+MNDKCAAGTGR +E I++L+ + ELG R+ + E E +SS CVVFA+SE + Sbjct: 135 RVREFVMNDKCAAGTGRFLEKIAELLDYRLDELGDRALEAE-ERATISSQCVVFAESEVI 193 Query: 212 GLLKAGYTKNMVIAAYCQAMAERVVSLLERIGVEEGFFITGGIAKNPGVVKRIERLLGIK 271 L G + + A A A RV +L+ RIG++ TGG++ N G+ + +E L+G Sbjct: 194 SLKVRGTRREDIAAGIHYASARRVRNLVNRIGLDPEIVFTGGVSNNKGMKRALEDLIGAP 253 Query: 272 QLETKIDSQIAGALGAAL 289 ETK+D+ AGALGAA+ Sbjct: 254 ISETKLDTTYAGALGAAV 271 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 283 Length adjustment: 26 Effective length of query: 275 Effective length of database: 257 Effective search space: 70675 Effective search space used: 70675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory