Align 3-hydroxybutyryl-CoA dehydrogenase; EC 1.1.1.157 (characterized)
to candidate WP_110804756.1 C8J30_RS05595 3-hydroxybutyryl-CoA dehydrogenase
Query= CharProtDB::CH_091789 (282 letters) >NCBI__GCF_003217355.1:WP_110804756.1 Length = 291 Score = 310 bits (793), Expect = 3e-89 Identities = 159/277 (57%), Positives = 195/277 (70%) Query: 4 VCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEATKV 63 V V+GAG MG+GIA FA G++V+L D+ E ++R + I KNL + V +GKI + Sbjct: 6 VGVVGAGQMGNGIAHVFALSGYDVLLNDVAPESLERAMGTIGKNLDRQVHRGKISHEERD 65 Query: 64 EILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLSITE 123 L RI T+ + DL+IEAA ER +K+ IF L KPETILASNTSS+SIT Sbjct: 66 AALGRIRTTLTIADLGQTDLIIEAATEREPVKQAIFDSLLPHLKPETILASNTSSISITR 125 Query: 124 VASATKRPDKVIGMHFFNPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVAEAP 183 +AS T RP+K IG+HF NP PVM+LVE+IRGIAT +ET+ + +GK P + P Sbjct: 126 LASRTDRPEKFIGVHFMNPVPVMQLVELIRGIATGEETYRTLLGVIERLGKTPASAEDFP 185 Query: 184 GFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDICLAIMD 243 F+VNRILIPMINEAV L EG+ +V+ ID AMKLGANHPMGPLEL DFIGLD CLAIM+ Sbjct: 186 AFIVNRILIPMINEAVYTLYEGVGNVQSIDMAMKLGANHPMGPLELADFIGLDTCLAIMN 245 Query: 244 VLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDY 280 VLY D+KYRP LL KYV AGWLGRK+G+GFYDY Sbjct: 246 VLYDGLADTKYRPCPLLTKYVEAGWLGRKTGRGFYDY 282 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 291 Length adjustment: 26 Effective length of query: 256 Effective length of database: 265 Effective search space: 67840 Effective search space used: 67840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory