Align ABC transporter for D-Alanine, periplasmic substrate-binding component (characterized)
to candidate WP_110804792.1 C8J30_RS05885 amino acid ABC transporter substrate-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5402 (343 letters) >NCBI__GCF_003217355.1:WP_110804792.1 Length = 338 Score = 333 bits (853), Expect = 5e-96 Identities = 167/340 (49%), Positives = 223/340 (65%), Gaps = 2/340 (0%) Query: 4 LKSTLAVMTAAAVLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDSTGKIVGIDA 63 +K ++ T A V V+G A A +TLD V+ +G + CGV+ GL GF PD+ G G D Sbjct: 1 MKKSVFFGTVALVALVAGAASA-STLDDVKARGQLICGVNPGLTGFGAPDANGNYQGFDV 59 Query: 64 DFCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDMLSRNSTMTSSRDAGMGLKFPGF 123 C+AVAAAV GD KV++ L + RFTAL SGE+DML+RNST T RD + L F Sbjct: 60 AACKAVAAAVLGDPMKVQYKALTGETRFTALASGEVDMLARNSTWTFGRDTELALDFVA- 118 Query: 124 ITYYDGIGFLANNKLGVKSAKELDGATICIQAGTTTELNVSDYFRANGLKYTPITFDTSD 183 + YYDG GF+ N LGV SAKELDGAT+C+Q GTTTE+N++DYF++N + YTP+ Sbjct: 119 VNYYDGQGFMVNKSLGVSSAKELDGATVCVQTGTTTEMNLADYFKSNNMTYTPVNIADDA 178 Query: 184 ESAKSLESGRCDVLTSDKSQLFAQRSKLASPKDYVVLPETISKEPLGPVVRNGDDEWLAI 243 E + +G CD T+D S L A R+ + + D V+LPE ISKEPL VR+GD+ W I Sbjct: 179 EGQQKFLAGACDSYTTDASGLAASRATMPNAADIVILPEIISKEPLALAVRHGDNNWGDI 238 Query: 244 VRWTGYALLNAEEAGVTSKNVEAEAKSTKNPDVARMLGADGEYGKDLKLPKDWVVQIVKQ 303 VRW+ YAL+ AEE G+T N+E A ST+NP++ R+LG +G+ GK + L D+ + + Sbjct: 239 VRWSFYALVAAEEYGITKANLEEVAASTQNPEIRRLLGLEGDMGKKIGLDNDFAKRAIMA 298 Query: 304 VGNYGEMFERNLGKGTPLEIDRGLNALWNAGGIQYAPPVR 343 GNYGE+FE N+G T + + RGLNA W GG+ YAPP R Sbjct: 299 SGNYGEIFEANIGASTSIGLARGLNAQWTQGGLMYAPPFR 338 Lambda K H 0.315 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 338 Length adjustment: 28 Effective length of query: 315 Effective length of database: 310 Effective search space: 97650 Effective search space used: 97650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory