Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate WP_110806073.1 C8J30_RS11875 acyl-CoA synthetase
Query= BRENDA::A4YDT1 (564 letters) >NCBI__GCF_003217355.1:WP_110806073.1 Length = 630 Score = 132 bits (332), Expect = 4e-35 Identities = 120/368 (32%), Positives = 168/368 (45%), Gaps = 21/368 (5%) Query: 191 EDTRGEDVIINYFTSGTTGMPKRVIHTAVSYPVGSITTASIVGVRESDLHLNLSATGWAK 250 ED + + V + T GTTGMPK H +++ R +D+ + Sbjct: 213 EDAKTDRVAAYFHTGGTTGMPKVAQHKYSGMVYNGWLGGTLL-FRHTDVMICPLPLFHVF 271 Query: 251 FAWSSFFSPLLVGATVV-----GINYEGKLDTRRYLGEVENLGVTSFCAPPTAWRQFITL 305 A+ S + GA VV G EG D L +E VT PTA + Sbjct: 272 AAYPILMSAIHSGAHVVFPTPAGYRGEGVFDNFWKL--IERWQVTFLITVPTAIAALMQR 329 Query: 306 DLDQFRFERLRSVVSAGEPLNPEVIKIWKDKFNLTIRDFYGQTETTAMVGNFPFLKVKP- 364 +D LR+ +S PL E+ +KD + I + YG TE T +V P K Sbjct: 330 KVDA-DISSLRTAISGSAPLPVELYNRFKDATGVEICEGYGLTEATCLVSINPVDGPKKV 388 Query: 365 GSMGKPHPLYDIRLL--DDEGKEITKPYEVGHITVKLNPRPIGLFLG--YSDEKKNMESF 420 GS+G P P +R+L + G EVG I V NP G+F G Y++ KN + F Sbjct: 389 GSVGIPLPYSHVRILRKTEAGFLECAADEVGEICVA-NP---GVFEGSTYTEVDKNHDLF 444 Query: 421 -REGYYYTGDKAYFDEEGYFYFVGRGDDVIKTSDYRVGPFEVESALLEHPAVAEAAVVGV 479 E + TGD D +GY + GR D+I + + P E+E ALL HPA+A A +G Sbjct: 445 AEERFLRTGDLGRIDPDGYLWITGRAKDLIIRGGHNIDPAEIEEALLAHPAIAFAGAIGQ 504 Query: 480 PDTVRWQLVKAYIVLKKGYMPSKELAEEIREKMKTLLSPYKVPRIIEFVDELPKTISGKI 539 PD +L AY+ L K + + E + + + VP+ IE +DELPKT GKI Sbjct: 505 PDAFAGELPCAYVELVKDATITPD--ELMAHAKRHIHERAAVPKHIEVLDELPKTAVGKI 562 Query: 540 RRVELRKR 547 + ELRKR Sbjct: 563 FKPELRKR 570 Lambda K H 0.318 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 719 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 564 Length of database: 630 Length adjustment: 37 Effective length of query: 527 Effective length of database: 593 Effective search space: 312511 Effective search space used: 312511 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory