Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_110805325.1 C8J30_RS08025 glyoxylate/hydroxypyruvate reductase A
Query= curated2:Q9YAW4 (335 letters) >NCBI__GCF_003217355.1:WP_110805325.1 Length = 312 Score = 103 bits (257), Expect = 6e-27 Identities = 64/176 (36%), Positives = 93/176 (52%), Gaps = 2/176 (1%) Query: 150 RGKTLGILGMGRIGSRVAEIGKAFGMRIIYHSRSRKREIEKELGAEYRSLEDLLRESDIL 209 R +++ +LG+G +G A+ G ++ SR++K + L L ++IL Sbjct: 135 RDRSVVVLGLGALGGACAQTLAGLGFQVTGWSRTQKTLPGVTCLSGAEGLRAALSRAEIL 194 Query: 210 SIHLPLTDETRHLIGESELKLMKKTAILVNTGRGAIVDTGALVKALREGWIAAAALDVFE 269 LP T ET L+ L L+ K A+++N GRG ++D AL+ AL G I A LDVF Sbjct: 195 VTVLPNTPETTDLLNTETLALLPKGAVILNPGRGNLIDDDALLAALDAGQIGHATLDVFR 254 Query: 270 EEPLNPNHPLTAFKNVVLAPHAASATRETRLRMAMMAAENLVAFAQGKVPPNLVNR 325 EPL P HP A V + PH A+ TR A + AEN+ F G+VP +LV+R Sbjct: 255 VEPLPPEHPYWAHPKVTVTPHIAAETRPA--SAARVIAENIRRFEAGEVPLHLVDR 308 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 312 Length adjustment: 28 Effective length of query: 307 Effective length of database: 284 Effective search space: 87188 Effective search space used: 87188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory