Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_110804244.1 C8J30_RS03245 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_003217355.1:WP_110804244.1 Length = 332 Score = 264 bits (675), Expect = 2e-75 Identities = 158/365 (43%), Positives = 207/365 (56%), Gaps = 37/365 (10%) Query: 1 MGQIQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDI 60 MG+I L +TKRFGD + + L I D EF+V VGPSGCGKST LR++AGLE + G I Sbjct: 1 MGEIVLKGVTKRFGDVEVIPPIDLAIHDGEFVVFVGPSGCGKSTLLRLIAGLEDVSGGKI 60 Query: 61 YIGGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAE 120 I G P +R +AMVFQ YALYPHM+V++NI F L+ + AE + +V A+ Sbjct: 61 EIDGKDATETAPSDRGLAMVFQSYALYPHMSVKKNIAFPLKMAK-LPPAEIEAKVQAAAK 119 Query: 121 TLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNL 180 L ++ LDRKP +LSGGQ+QRVA+GRAIVR PE FL DEPLSNLDA LR MR E+ L Sbjct: 120 VLNLSAYLDRKPGQLSGGQRQRVAIGRAIVRSPEAFLFDEPLSNLDAALRVNMRLEISEL 179 Query: 181 QDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMI 240 L T +YVTH+Q EAMTMAD+I V+ G ++QV SP E Y P N FVA FIG P + Sbjct: 180 HHTLKTTMIYVTHDQVEAMTMADKIVVLQAGRIEQVGSPLELYRTPRNRFVAGFIGSPKM 239 Query: 241 NLVRGTRSESTFVGEHFSYPLDEDVMESVDDRDDFVLGVRPEDIEVADAAPDDAALDDHD 300 N + G +E+ G H +G+RPE I ++ + Sbjct: 240 NFIEG--AEAAKHGAH-------------------AIGIRPEHIRISTT--------EGM 270 Query: 301 LQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHL-VTRGDRVTVTIPPDKIHLF 359 + V V E G LH+ + + L V G + + GD V ++ ++H F Sbjct: 271 WKGTVGVSEHLGSDTFLHV------TTEHGLLNVRAGGEVDLHHGDSVFLSPDMAQLHRF 324 Query: 360 DAETG 364 D E G Sbjct: 325 DKEGG 329 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 332 Length adjustment: 29 Effective length of query: 354 Effective length of database: 303 Effective search space: 107262 Effective search space used: 107262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory