Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_110805339.1 C8J30_RS08100 ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_003217355.1:WP_110805339.1 Length = 348 Score = 237 bits (604), Expect = 4e-67 Identities = 131/284 (46%), Positives = 187/284 (65%), Gaps = 11/284 (3%) Query: 13 YTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVL 72 + ++ G + V++ +L ++ GEF+ L+GPSGCGK+T LRM+AG E T G + + + + Sbjct: 8 HLEKSFGTLRVVKDFNLTVEKGEFISLLGPSGCGKTTVLRMVAGFELPTSGAITIAGKEV 67 Query: 73 NGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDMLGISDL 132 + R+I MVFQ+YAL+P+ +V N+ FGL+ G P I +RVEE ++G+ DL Sbjct: 68 TDLKPNQRNIGMVFQAYALFPNLTVAQNVGFGLKVK-GTPKAAIDKRVEEMLSLIGLPDL 126 Query: 133 LDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVT 192 +R P QLSGGQQQRVAL RA+ P V L+DEPLS LDAK+R +R E++ +Q ELG+T Sbjct: 127 GNRYPFQLSGGQQQRVALARALAPKPSVLLLDEPLSALDAKVRVSLRNEIRAIQRELGIT 186 Query: 193 TVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSL 252 T++VTHDQ EA++M DRV V+ +G QVGTP D Y+RP+ FVA F+G ++N + + Sbjct: 187 TIFVTHDQEEALSMSDRVVVMHEGIADQVGTPFDIYNRPSTRFVASFVG--TLNTLNVQV 244 Query: 253 SGDTFRGDGFDYPLSGATRDQLGGA--SG-LTLGIRPEDVTVGE 293 D G GAT LG + SG +TLG+RPE VT+G+ Sbjct: 245 L-DAANG----RVKLGATEIALGRSLPSGPVTLGLRPEAVTLGQ 283 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 348 Length adjustment: 30 Effective length of query: 353 Effective length of database: 318 Effective search space: 112254 Effective search space used: 112254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory