Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_110804307.1 C8J30_RS03205 sugar ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_003217355.1:WP_110804307.1 Length = 257 Score = 193 bits (490), Expect = 3e-54 Identities = 110/250 (44%), Positives = 162/250 (64%), Gaps = 8/250 (3%) Query: 1 MSDLLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGD 60 M +L R + K +G V ALD E+ GE++A++GDNGAGKSTLIK +SG PD G+ Sbjct: 1 MDPILTARGLTKRYGKVTALDHCDFELYPGEILAVIGDNGAGKSTLIKALSGAVIPDEGE 60 Query: 61 LVFEGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLARE-----VTNKIF--LN 113 + EG+ + F SP DAR+ GIET+YQ LA+ P L I N+F+ RE + K+F L+ Sbjct: 61 IRLEGQPINFASPLDARAKGIETVYQTLAMSPALSIADNMFMGRELRRPGMMGKLFRMLD 120 Query: 114 KKKMMEESKKLLDSLQI-RIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAAL 172 + +M +++ L L + I DIN VE+LSGGQRQ VAVARA F +K+I++DEPTAAL Sbjct: 121 RPQMERIAREKLSELGLMTIQDINQAVESLSGGQRQGVAVARAAAFGSKVIILDEPTAAL 180 Query: 173 SVVEARKVLELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEE 232 V E+R+VLEL ++K +G+ +++I+HN+ +EVADRI++ G+ + ++ + + Sbjct: 181 GVKESRRVLELILDVKARGIPIILISHNMPHVFEVADRIHIHRLGRRLCVIDPKQYTMSD 240 Query: 233 ITEVMTSFAL 242 MT L Sbjct: 241 AVAFMTGAKL 250 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 257 Length adjustment: 24 Effective length of query: 227 Effective length of database: 233 Effective search space: 52891 Effective search space used: 52891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory