Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_110805339.1 C8J30_RS08100 ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_003217355.1:WP_110805339.1 Length = 348 Score = 167 bits (422), Expect = 3e-46 Identities = 94/239 (39%), Positives = 145/239 (60%), Gaps = 12/239 (5%) Query: 2 IKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITIK 61 + + L KSFG V+K+ + T+ +GE ++++GPSG GK+T LR + E P G ITI Sbjct: 4 LSLTHLEKSFGTLRVVKDFNLTVEKGEFISLLGPSGCGKTTVLRMVAGFELPTSGAITIA 63 Query: 62 DTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKAEDLL 121 E+T K N + NIGMVFQ + LFP+ TV +N+ + + VK K A ++ E++L Sbjct: 64 GKEVTDLKPN----QRNIGMVFQAYALFPNLTVAQNVGFG-LKVKGTPKAAIDKRVEEML 118 Query: 122 RKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPE----MVKEVLQ 177 +GL + N YP +LSGGQ+QRVA+ARALA P ++L DEP SALD + + E+ Sbjct: 119 SLIGLPDLGNRYPFQLSGGQQQRVALARALAPKPSVLLLDEPLSALDAKVRVSLRNEIRA 178 Query: 178 VMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFL 236 + +EL G+T + VTH+ A ++DRV+ M +G+ + G P + + P ++ F+ Sbjct: 179 IQREL---GITTIFVTHDQEEALSMSDRVVVMHEGIADQVGTPFDIYNRPSTRFVASFV 234 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 348 Length adjustment: 26 Effective length of query: 214 Effective length of database: 322 Effective search space: 68908 Effective search space used: 68908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory