Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_110804793.1 C8J30_RS05890 ABC transporter permease subunit
Query= TCDB::Q88NY3 (248 letters) >NCBI__GCF_003217355.1:WP_110804793.1 Length = 426 Score = 91.7 bits (226), Expect = 2e-23 Identities = 71/224 (31%), Positives = 112/224 (50%), Gaps = 18/224 (8%) Query: 26 ITGLGWTIAIAITAW-IIALLLGSLLG----------VMRTVPNRLVSGIATAYVELFRN 74 + +GW + +++ A +IA++ S G V T R V+ + + LF Sbjct: 204 VVDIGWNLPVSLNALAVIAVMAASFWGWRRFMARAKAVQETTGRRPVTWWPSLLI-LFAP 262 Query: 75 VPLLVQLFIWYFLVPDLLPEGLQEWFKQDLNPTTSALISVVICLGLFTAARVCEQVRTGI 134 + L+ ++ P + F Q L+ T+ LI+ L L+TAA + E VR GI Sbjct: 263 IIALLYALGFHLDYPKITKFDFTGGF-QMLHSFTALLIA----LTLYTAAFIAEIVRAGI 317 Query: 135 QALPKGQEAAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMEL 194 QA+ KGQ AA A+G + + V+LPQA R+I+PPL S+FLN+ KNSS+A + M+L Sbjct: 318 QAISKGQSEAAYALGLRPGRTMSLVILPQALRVIVPPLISQFLNLTKNSSLAIAVSYMDL 377 Query: 195 LAQTKQ-TAEFSANLFEAFTLATLIYFTLNMGLMLLMRMVEKKV 237 T + E L LIY T+++ + LM + K + Sbjct: 378 RGTLGGITLNQTGRELECMLLMMLIYLTISLTISSLMNIYNKSI 421 Score = 55.1 bits (131), Expect = 2e-12 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 4/76 (5%) Query: 19 ETYLDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLL 78 +T+ I GL T+ +++ I+A +LG+++GV+R N LV+ I T YVE FRN+PLL Sbjct: 82 DTHFRALIEGLLNTLLVSVLGCILATVLGTVIGVLRLSHNWLVARIMTVYVETFRNIPLL 141 Query: 79 VQLFIWYFLVPDLLPE 94 +W L+ +L E Sbjct: 142 ----LWILLMGTILAE 153 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 248 Length of database: 426 Length adjustment: 28 Effective length of query: 220 Effective length of database: 398 Effective search space: 87560 Effective search space used: 87560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory